Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2023487..2024141 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | PIH14_RS09825 | Protein ID | WP_000244777.1 |
Coordinates | 2023487..2023894 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIH14_RS09830 | Protein ID | WP_000354046.1 |
Coordinates | 2023875..2024141 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS09805 (2019444) | 2019444..2021177 | - | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PIH14_RS09810 (2021183) | 2021183..2021893 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIH14_RS09815 (2021918) | 2021918..2022814 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PIH14_RS09820 (2022926) | 2022926..2023447 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIH14_RS09825 (2023487) | 2023487..2023894 | - | 408 | WP_000244777.1 | protein YgfX | Toxin |
PIH14_RS09830 (2023875) | 2023875..2024141 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIH14_RS09835 (2024384) | 2024384..2025364 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
PIH14_RS09840 (2025560) | 2025560..2026219 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
PIH14_RS09845 (2026383) | 2026383..2026694 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
PIH14_RS09850 (2026739) | 2026739..2028172 | + | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
PIH14_RS09855 (2028229) | 2028229..2028972 | - | 744 | WP_000951962.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T267733 WP_000244777.1 NZ_CP116046:c2023894-2023487 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |