Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1899417..1900000 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | PIH14_RS09295 | Protein ID | WP_000254738.1 |
Coordinates | 1899417..1899752 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PIH14_RS09300 | Protein ID | WP_000581937.1 |
Coordinates | 1899752..1900000 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS09280 (1895304) | 1895304..1896602 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PIH14_RS09285 (1896690) | 1896690..1898327 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PIH14_RS09290 (1898555) | 1898555..1899346 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PIH14_RS09295 (1899417) | 1899417..1899752 | - | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
PIH14_RS09300 (1899752) | 1899752..1900000 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PIH14_RS09305 (1900078) | 1900078..1902312 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PIH14_RS09310 (1902360) | 1902360..1903661 | - | 1302 | WP_105907854.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T267732 WP_000254738.1 NZ_CP116046:c1899752-1899417 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|