Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1116287..1117118 | Replicon | chromosome |
| Accession | NZ_CP116046 | ||
| Organism | Escherichia coli strain EC812A1 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | PIH14_RS05620 | Protein ID | WP_000854814.1 |
| Coordinates | 1116744..1117118 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | PIH14_RS05615 | Protein ID | WP_001285585.1 |
| Coordinates | 1116287..1116655 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIH14_RS05570 (1111489) | 1111489..1111734 | + | 246 | Protein_1093 | transposase | - |
| PIH14_RS05575 (1111747) | 1111747..1112898 | - | 1152 | WP_001254932.1 | IS30-like element IS30 family transposase | - |
| PIH14_RS05580 (1113445) | 1113445..1113813 | - | 369 | Protein_1095 | zinc-ribbon domain-containing protein | - |
| PIH14_RS05585 (1113801) | 1113801..1114202 | - | 402 | WP_000270974.1 | putative zinc ribbon protein | - |
| PIH14_RS05590 (1114462) | 1114462..1114548 | - | 87 | Protein_1097 | inovirus-type Gp2 protein | - |
| PIH14_RS05595 (1114548) | 1114548..1114880 | + | 333 | Protein_1098 | DUF932 domain-containing protein | - |
| PIH14_RS05600 (1114962) | 1114962..1115441 | + | 480 | WP_000860087.1 | antirestriction protein | - |
| PIH14_RS05605 (1115453) | 1115453..1115929 | + | 477 | WP_001186726.1 | RadC family protein | - |
| PIH14_RS05610 (1115992) | 1115992..1116213 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| PIH14_RS05615 (1116287) | 1116287..1116655 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| PIH14_RS05620 (1116744) | 1116744..1117118 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PIH14_RS05625 (1117115) | 1117115..1117309 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| PIH14_RS05630 (1117355) | 1117355..1117435 | + | 81 | Protein_1105 | hypothetical protein | - |
| PIH14_RS05635 (1117724) | 1117724..1117852 | - | 129 | Protein_1106 | transposase domain-containing protein | - |
| PIH14_RS05640 (1117972) | 1117972..1118106 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| PIH14_RS05645 (1118207) | 1118207..1118536 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| PIH14_RS05650 (1118708) | 1118708..1119766 | - | 1059 | WP_271293169.1 | FUSC family protein | - |
| PIH14_RS05655 (1119964) | 1119964..1120437 | - | 474 | WP_271293170.1 | DNA gyrase inhibitor SbmC | - |
| PIH14_RS05660 (1120556) | 1120556..1121722 | - | 1167 | WP_001296209.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T267731 WP_000854814.1 NZ_CP116046:1116744-1117118 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT267731 WP_001285585.1 NZ_CP116046:1116287-1116655 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |