Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 51658..52283 | Replicon | plasmid p_STEC1575_1 |
| Accession | NZ_CP116045 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PHA55_RS24430 | Protein ID | WP_000911315.1 |
| Coordinates | 51885..52283 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | L4J1D2 |
| Locus tag | PHA55_RS24425 | Protein ID | WP_000450532.1 |
| Coordinates | 51658..51885 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS24425 (51658) | 51658..51885 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PHA55_RS24430 (51885) | 51885..52283 | + | 399 | WP_000911315.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PHA55_RS24435 (52292) | 52292..54445 | - | 2154 | WP_161619128.1 | type IV conjugative transfer system coupling protein TraD | - |
| PHA55_RS24440 (54698) | 54698..55429 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
| PHA55_RS24445 (55454) | 55454..55975 | - | 522 | WP_000632670.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyD | 1..88676 | 88676 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14871.17 Da Isoelectric Point: 8.5264
>T267724 WP_000911315.1 NZ_CP116045:51885-52283 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQARPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQARPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|