Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 38915..39462 Replicon plasmid p_STEC1575_1
Accession NZ_CP116045
Organism Escherichia coli strain STEC1575

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PHA55_RS24360 Protein ID WP_001384452.1
Coordinates 38915..39193 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID K4JYR0
Locus tag PHA55_RS24365 Protein ID WP_000079928.1
Coordinates 39193..39462 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA55_RS24330 (34095) 34095..34843 + 749 Protein_40 IS3-like element IS3 family transposase -
PHA55_RS24335 (34926) 34926..35948 + 1023 WP_000255944.1 IS21-like element IS100 family transposase -
PHA55_RS24340 (35945) 35945..36727 + 783 WP_001300609.1 IS21-like element IS100kyp family helper ATPase IstB -
PHA55_RS24345 (36794) 36794..37216 + 423 Protein_43 IS3 family transposase -
PHA55_RS24350 (37388) 37388..37480 - 93 Protein_44 hypothetical protein -
PHA55_RS24355 (37479) 37479..38606 - 1128 WP_249544656.1 YiiX/YebB-like N1pC/P60 family cysteine hydrolase -
PHA55_RS24360 (38915) 38915..39193 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PHA55_RS24365 (39193) 39193..39462 - 270 WP_000079928.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PHA55_RS24370 (40376) 40376..41233 - 858 WP_001401515.1 incFII family plasmid replication initiator RepA -
PHA55_RS24375 (41226) 41226..41300 - 75 WP_001375168.1 RepA leader peptide Tap -
PHA55_RS24380 (41534) 41534..41791 - 258 WP_000083826.1 replication regulatory protein RepA -
PHA55_RS24385 (42031) 42031..42621 - 591 WP_032082916.1 DUF2726 domain-containing protein -
PHA55_RS24390 (42659) 42659..42868 - 210 WP_001302200.1 hemolysin expression modulator Hha -
PHA55_RS24395 (42914) 42914..43375 - 462 WP_021545193.1 thermonuclease family protein -
PHA55_RS24400 (43674) 43674..43832 - 159 WP_021545194.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - hlyD 1..88676 88676


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T267723 WP_001384452.1 NZ_CP116045:c39193-38915 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10175.50 Da        Isoelectric Point: 7.3210

>AT267723 WP_000079928.1 NZ_CP116045:c39462-39193 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A5W2J4D0

References