Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 8455..8980 | Replicon | plasmid p_STEC1575_1 |
| Accession | NZ_CP116045 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | PHA55_RS24195 | Protein ID | WP_001159871.1 |
| Coordinates | 8455..8760 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PHA55_RS24200 | Protein ID | WP_000813634.1 |
| Coordinates | 8762..8980 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS24165 (3722) | 3722..4992 | + | 1271 | Protein_7 | translesion error-prone DNA polymerase V subunit UmuC | - |
| PHA55_RS24170 (4997) | 4997..5389 | - | 393 | WP_000340833.1 | plasmid partitioning/stability family protein | - |
| PHA55_RS24175 (5394) | 5394..6365 | - | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
| PHA55_RS24180 (6594) | 6594..7238 | + | 645 | WP_000633911.1 | AAA family ATPase | - |
| PHA55_RS24185 (7232) | 7232..7507 | + | 276 | WP_000239529.1 | hypothetical protein | - |
| PHA55_RS24190 (7645) | 7645..8454 | - | 810 | WP_161619134.1 | site-specific integrase | - |
| PHA55_RS24195 (8455) | 8455..8760 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PHA55_RS24200 (8762) | 8762..8980 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PHA55_RS24205 (9935) | 9935..10138 | - | 204 | Protein_15 | integrase core domain-containing protein | - |
| PHA55_RS24210 (11208) | 11208..11864 | + | 657 | WP_235150763.1 | PIG-L family deacetylase | - |
| PHA55_RS24215 (11875) | 11875..13071 | + | 1197 | WP_161619135.1 | glycosyltransferase family 2 protein | - |
| PHA55_RS24220 (13049) | 13049..13630 | + | 582 | WP_096934554.1 | acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyD | 1..88676 | 88676 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T267722 WP_001159871.1 NZ_CP116045:c8760-8455 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3TCJ | |
| PDB | 2H3A | |
| PDB | 2ADN | |
| PDB | 2ADL | |
| PDB | 3HPW | |
| PDB | 2H3C | |
| PDB | 3G7Z | |
| AlphaFold DB | A0A829CQY2 |