Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2416925..2417563 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PHA55_RS11810 | Protein ID | WP_000813794.1 |
| Coordinates | 2416925..2417101 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PHA55_RS11815 | Protein ID | WP_001270286.1 |
| Coordinates | 2417147..2417563 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS11790 (2412544) | 2412544..2413758 | - | 1215 | WP_071601296.1 | BenE family transporter YdcO | - |
| PHA55_RS11795 (2413811) | 2413811..2414347 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PHA55_RS11800 (2414420) | 2414420..2416381 | + | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PHA55_RS11805 (2416473) | 2416473..2416703 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| PHA55_RS11810 (2416925) | 2416925..2417101 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PHA55_RS11815 (2417147) | 2417147..2417563 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PHA55_RS11820 (2417642) | 2417642..2419048 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| PHA55_RS11825 (2419293) | 2419293..2420438 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| PHA55_RS11830 (2420456) | 2420456..2421469 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| PHA55_RS11835 (2421470) | 2421470..2422411 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2411356..2412504 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T267709 WP_000813794.1 NZ_CP116044:2416925-2417101 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT267709 WP_001270286.1 NZ_CP116044:2417147-2417563 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|