Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1329397..1330234 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | PHA55_RS06475 | Protein ID | WP_000227784.1 |
| Coordinates | 1329397..1329939 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | PHA55_RS06480 | Protein ID | WP_001297137.1 |
| Coordinates | 1329923..1330234 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS06455 (1324936) | 1324936..1325847 | - | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
| PHA55_RS06460 (1326015) | 1326015..1326506 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| PHA55_RS06465 (1326634) | 1326634..1327998 | - | 1365 | WP_001000978.1 | MFS transporter | - |
| PHA55_RS06470 (1328406) | 1328406..1329341 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| PHA55_RS06475 (1329397) | 1329397..1329939 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| PHA55_RS06480 (1329923) | 1329923..1330234 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| PHA55_RS06485 (1330419) | 1330419..1331309 | - | 891 | WP_000971336.1 | heme o synthase | - |
| PHA55_RS06490 (1331321) | 1331321..1331650 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| PHA55_RS06495 (1331650) | 1331650..1332264 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| PHA55_RS06500 (1332254) | 1332254..1334245 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| PHA55_RS06505 (1334267) | 1334267..1335214 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T267699 WP_000227784.1 NZ_CP116044:c1329939-1329397 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|