Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
| Location | 389596..390640 | Replicon | chromosome |
| Accession | NZ_CP116044 | ||
| Organism | Escherichia coli strain STEC1575 | ||
Toxin (Protein)
| Gene name | panT | Uniprot ID | - |
| Locus tag | PHA55_RS01820 | Protein ID | WP_053878051.1 |
| Coordinates | 390092..390640 (+) | Length | 183 a.a. |
Antitoxin (Protein)
| Gene name | panA | Uniprot ID | A0A799QL68 |
| Locus tag | PHA55_RS01815 | Protein ID | WP_059242328.1 |
| Coordinates | 389596..390069 (+) | Length | 158 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA55_RS01780 (384601) | 384601..385209 | + | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
| PHA55_RS01785 (385282) | 385282..386607 | + | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
| PHA55_RS01790 (386723) | 386723..386932 | + | 210 | WP_001030593.1 | CsbD family protein | - |
| PHA55_RS01795 (386974) | 386974..387489 | - | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
| PHA55_RS01800 (387807) | 387807..388088 | + | 282 | Protein_332 | DUF2713 domain-containing protein | - |
| PHA55_RS01805 (388116) | 388116..388823 | + | 708 | WP_015364382.1 | DUF2713 family protein | - |
| PHA55_RS01810 (389186) | 389186..389287 | + | 102 | Protein_334 | tRNA-dihydrouridine synthase | - |
| PHA55_RS01815 (389596) | 389596..390069 | + | 474 | WP_059242328.1 | DUF4065 domain-containing protein | Antitoxin |
| PHA55_RS01820 (390092) | 390092..390640 | + | 549 | WP_053878051.1 | hypothetical protein | Toxin |
| PHA55_RS01825 (390674) | 390674..390946 | - | 273 | WP_001093911.1 | pyocin activator PrtN family protein | - |
| PHA55_RS01830 (390983) | 390983..391555 | - | 573 | WP_097455382.1 | 3'-5' exonuclease | - |
| PHA55_RS01835 (391555) | 391555..392517 | - | 963 | WP_271287488.1 | ead/Ea22-like family protein | - |
| PHA55_RS01840 (392583) | 392583..392891 | - | 309 | Protein_340 | hypothetical protein | - |
| PHA55_RS01845 (392884) | 392884..393138 | - | 255 | WP_027661982.1 | hypothetical protein | - |
| PHA55_RS01850 (393135) | 393135..393374 | - | 240 | WP_000476211.1 | hypothetical protein | - |
| PHA55_RS01855 (393367) | 393367..393570 | - | 204 | WP_000111289.1 | hypothetical protein | - |
| PHA55_RS01860 (393567) | 393567..393929 | - | 363 | WP_097455379.1 | hypothetical protein | - |
| PHA55_RS01865 (393920) | 393920..394456 | - | 537 | WP_271287489.1 | 5'-deoxynucleotidase | - |
| PHA55_RS01870 (394585) | 394585..395409 | - | 825 | WP_097455378.1 | YfdQ family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | stx2A / stx2B | 384601..439893 | 55292 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20096.62 Da Isoelectric Point: 4.5890
>T267696 WP_053878051.1 NZ_CP116044:390092-390640 [Escherichia coli]
MSRNSDIYKLIGAAAGVENGRSEASLNYTDSQEQVFKSAFEPSNHESDDDSSSENKAILEEEEFGSNTGALHEFMQQHRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVCFMSWWCLFVAVMFVSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDGDKEK
MSRNSDIYKLIGAAAGVENGRSEASLNYTDSQEQVFKSAFEPSNHESDDDSSSENKAILEEEEFGSNTGALHEFMQQHRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVCFMSWWCLFVAVMFVSFLIAHEGKPPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDGDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17369.87 Da Isoelectric Point: 7.9143
>AT267696 WP_059242328.1 NZ_CP116044:389596-390069 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQTYNGIGSSIIPDDAIKTYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQTYNGIGSSIIPDDAIKTYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|