Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4440475..4441256 | Replicon | chromosome |
Accession | NZ_CP116042 | ||
Organism | Salmonella enterica subsp. enterica serovar 14[5]12:i:- strain BL708 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | E8X9W8 |
Locus tag | PGC28_RS21840 | Protein ID | WP_000626099.1 |
Coordinates | 4440475..4440966 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | PGC28_RS21845 | Protein ID | WP_001110452.1 |
Coordinates | 4440963..4441256 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGC28_RS21800 (4435661) | 4435661..4435903 | - | 243 | WP_197603740.1 | hypothetical protein | - |
PGC28_RS21805 (4435900) | 4435900..4436256 | - | 357 | WP_033567083.1 | hypothetical protein | - |
PGC28_RS21810 (4436253) | 4436253..4437125 | - | 873 | WP_033567082.1 | ParA family protein | - |
PGC28_RS21815 (4437316) | 4437316..4437393 | - | 78 | Protein_4267 | helix-turn-helix domain-containing protein | - |
PGC28_RS21820 (4437484) | 4437484..4437816 | - | 333 | WP_001165471.1 | MerR family transcriptional regulator | - |
PGC28_RS21825 (4437888) | 4437888..4438265 | + | 378 | WP_000916345.1 | EthD family reductase | - |
PGC28_RS21830 (4439298) | 4439298..4439372 | + | 75 | Protein_4270 | porin family protein | - |
PGC28_RS21835 (4439475) | 4439475..4440227 | + | 753 | WP_000842434.1 | non-specific acid phosphatase | - |
PGC28_RS21840 (4440475) | 4440475..4440966 | - | 492 | WP_000626099.1 | GNAT family N-acetyltransferase | Toxin |
PGC28_RS21845 (4440963) | 4440963..4441256 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
PGC28_RS21850 (4441573) | 4441573..4441794 | + | 222 | WP_001576552.1 | hypothetical protein | - |
PGC28_RS21855 (4442059) | 4442059..4442934 | + | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PGC28_RS21860 (4442931) | 4442931..4443218 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PGC28_RS21865 (4443241) | 4443241..4443456 | + | 216 | WP_001595136.1 | hypothetical protein | - |
PGC28_RS21870 (4443464) | 4443464..4443733 | + | 270 | WP_010989096.1 | hypothetical protein | - |
PGC28_RS21875 (4444027) | 4444027..4444932 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17646.39 Da Isoelectric Point: 6.8437
>T267692 WP_000626099.1 NZ_CP116042:c4440966-4440475 [Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:-]
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLEQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT267692 WP_001110452.1 NZ_CP116042:c4441256-4440963 [Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:-]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |