Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4230397..4230913 | Replicon | chromosome |
| Accession | NZ_CP116042 | ||
| Organism | Salmonella enterica subsp. enterica serovar 14[5]12:i:- strain BL708 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PGC28_RS20730 | Protein ID | WP_000220578.1 |
| Coordinates | 4230397..4230681 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PGC28_RS20735 | Protein ID | WP_000212724.1 |
| Coordinates | 4230671..4230913 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGC28_RS20715 (4225609) | 4225609..4227261 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
| PGC28_RS20720 (4227670) | 4227670..4229808 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PGC28_RS20725 (4229929) | 4229929..4230393 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PGC28_RS20730 (4230397) | 4230397..4230681 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PGC28_RS20735 (4230671) | 4230671..4230913 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PGC28_RS20740 (4230991) | 4230991..4232904 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
| PGC28_RS20745 (4232921) | 4232921..4233661 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| PGC28_RS20750 (4233658) | 4233658..4234776 | - | 1119 | WP_001139182.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PGC28_RS20755 (4234760) | 4234760..4235893 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T267691 WP_000220578.1 NZ_CP116042:c4230681-4230397 [Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:-]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |