Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3517222..3517842 | Replicon | chromosome |
Accession | NZ_CP116042 | ||
Organism | Salmonella enterica subsp. enterica serovar 14[5]12:i:- strain BL708 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PGC28_RS17455 | Protein ID | WP_001280991.1 |
Coordinates | 3517624..3517842 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PGC28_RS17450 | Protein ID | WP_000344807.1 |
Coordinates | 3517222..3517596 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGC28_RS17440 (3512361) | 3512361..3513554 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PGC28_RS17445 (3513577) | 3513577..3516726 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
PGC28_RS17450 (3517222) | 3517222..3517596 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PGC28_RS17455 (3517624) | 3517624..3517842 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PGC28_RS17460 (3518021) | 3518021..3518572 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
PGC28_RS17465 (3518689) | 3518689..3519159 | + | 471 | WP_000136181.1 | YlaC family protein | - |
PGC28_RS17470 (3519215) | 3519215..3519355 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PGC28_RS17475 (3519361) | 3519361..3519621 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PGC28_RS17480 (3519846) | 3519846..3521396 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
PGC28_RS17490 (3521627) | 3521627..3522016 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PGC28_RS17495 (3522049) | 3522049..3522618 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T267687 WP_001280991.1 NZ_CP116042:3517624-3517842 [Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:-]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT267687 WP_000344807.1 NZ_CP116042:3517222-3517596 [Salmonella enterica subsp. enterica serovar 1,4,[5],12:i:-]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|