Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 2150132..2150771 | Replicon | chromosome |
Accession | NZ_CP116040 | ||
Organism | Acinetobacter haemolyticus strain HW-2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PGW89_RS10125 | Protein ID | WP_113996648.1 |
Coordinates | 2150376..2150771 (+) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | N9FB90 |
Locus tag | PGW89_RS10120 | Protein ID | WP_004641025.1 |
Coordinates | 2150132..2150389 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGW89_RS10095 (PGW89_10095) | 2145207..2145572 | + | 366 | WP_004641032.1 | 50S ribosomal protein L17 | - |
PGW89_RS10100 (PGW89_10100) | 2145737..2146234 | + | 498 | WP_017395331.1 | GNAT family N-acetyltransferase | - |
PGW89_RS10105 (PGW89_10105) | 2146612..2148102 | + | 1491 | WP_017395332.1 | NAD(P)/FAD-dependent oxidoreductase | - |
PGW89_RS10110 (PGW89_10110) | 2148225..2148722 | + | 498 | WP_113996647.1 | DUF2059 domain-containing protein | - |
PGW89_RS10115 (PGW89_10115) | 2148773..2149945 | - | 1173 | WP_005086825.1 | acyl-CoA dehydrogenase family protein | - |
PGW89_RS10120 (PGW89_10120) | 2150132..2150389 | + | 258 | WP_004641025.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
PGW89_RS10125 (PGW89_10125) | 2150376..2150771 | + | 396 | WP_113996648.1 | hypothetical protein | Toxin |
PGW89_RS10130 (PGW89_10130) | 2150982..2151188 | + | 207 | WP_026056364.1 | hypothetical protein | - |
PGW89_RS10135 (PGW89_10135) | 2151548..2152591 | + | 1044 | WP_113996649.1 | hypothetical protein | - |
PGW89_RS10140 (PGW89_10140) | 2152719..2153300 | + | 582 | WP_004641018.1 | rhombosortase | - |
PGW89_RS10145 (PGW89_10145) | 2153478..2155688 | + | 2211 | WP_004641016.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 1998820..2161476 | 162656 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 16053.36 Da Isoelectric Point: 9.1821
>T267674 WP_113996648.1 NZ_CP116040:2150376-2150771 [Acinetobacter haemolyticus]
MSTADRVFVLKRSRFAFAFQLFIFIVLISLLYYLLPWFLWLVSFPLMLIAWVLLLKQPQLKHFEYLDDQLCSLCFSDEMQ
GIEQRKIRKMIDHQCYIVIYFYDSQCRPCVIWWDQLSILQWKKLKKWVKLA
MSTADRVFVLKRSRFAFAFQLFIFIVLISLLYYLLPWFLWLVSFPLMLIAWVLLLKQPQLKHFEYLDDQLCSLCFSDEMQ
GIEQRKIRKMIDHQCYIVIYFYDSQCRPCVIWWDQLSILQWKKLKKWVKLA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|