Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 57714..58239 | Replicon | plasmid unnamed2 |
Accession | NZ_CP116037 | ||
Organism | Escherichia coli strain FAH |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | PGH49_RS25755 | Protein ID | WP_001159868.1 |
Coordinates | 57934..58239 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PGH49_RS25750 | Protein ID | WP_000813634.1 |
Coordinates | 57714..57932 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGH49_RS25720 (PGH49_25720) | 53107..53523 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
PGH49_RS25725 (PGH49_25725) | 53520..53750 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PGH49_RS25730 (PGH49_25730) | 54015..54515 | + | 501 | WP_001773886.1 | HEPN family nuclease | - |
PGH49_RS25735 (PGH49_25735) | 54528..55301 | + | 774 | WP_000905949.1 | hypothetical protein | - |
PGH49_RS25740 (PGH49_25740) | 55468..56601 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
PGH49_RS25745 (PGH49_25745) | 56635..57147 | - | 513 | WP_000151784.1 | hypothetical protein | - |
PGH49_RS25750 (PGH49_25750) | 57714..57932 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PGH49_RS25755 (PGH49_25755) | 57934..58239 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PGH49_RS25760 (PGH49_25760) | 58240..59046 | + | 807 | WP_000016982.1 | site-specific integrase | - |
PGH49_RS25765 (PGH49_25765) | 59820..60575 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PGH49_RS25770 (PGH49_25770) | 61163..62329 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | senB | 1..82743 | 82743 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T267672 WP_001159868.1 NZ_CP116037:57934-58239 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|