Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 53107..53750 Replicon plasmid unnamed2
Accession NZ_CP116037
Organism Escherichia coli strain FAH

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PGH49_RS25720 Protein ID WP_001034046.1
Coordinates 53107..53523 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PGH49_RS25725 Protein ID WP_001261278.1
Coordinates 53520..53750 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGH49_RS25705 (PGH49_25705) 48244..48660 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
PGH49_RS25710 (PGH49_25710) 48657..48887 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PGH49_RS25715 (PGH49_25715) 49268..53062 + 3795 WP_001144732.1 hypothetical protein -
PGH49_RS25720 (PGH49_25720) 53107..53523 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PGH49_RS25725 (PGH49_25725) 53520..53750 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PGH49_RS25730 (PGH49_25730) 54015..54515 + 501 WP_001773886.1 HEPN family nuclease -
PGH49_RS25735 (PGH49_25735) 54528..55301 + 774 WP_000905949.1 hypothetical protein -
PGH49_RS25740 (PGH49_25740) 55468..56601 + 1134 WP_001542067.1 DUF3800 domain-containing protein -
PGH49_RS25745 (PGH49_25745) 56635..57147 - 513 WP_000151784.1 hypothetical protein -
PGH49_RS25750 (PGH49_25750) 57714..57932 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PGH49_RS25755 (PGH49_25755) 57934..58239 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - senB 1..82743 82743


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T267671 WP_001034046.1 NZ_CP116037:c53523-53107 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT267671 WP_001261278.1 NZ_CP116037:c53750-53520 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References