Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4236062..4236876 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | S1PA82 |
| Locus tag | PGH49_RS20965 | Protein ID | WP_001054376.1 |
| Coordinates | 4236062..4236319 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | S1NWL7 |
| Locus tag | PGH49_RS20970 | Protein ID | WP_001540600.1 |
| Coordinates | 4236331..4236876 (+) | Length | 182 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS20940 (4231350) | 4231350..4232456 | + | 1107 | WP_001774143.1 | N-acetylneuraminate epimerase | - |
| PGH49_RS20945 (4232521) | 4232521..4233501 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| PGH49_RS20950 (4233611) | 4233611..4233816 | + | 206 | Protein_4100 | HNH endonuclease | - |
| PGH49_RS20955 (4234084) | 4234084..4235324 | - | 1241 | Protein_4101 | helicase YjhR | - |
| PGH49_RS20960 (4235440) | 4235440..4235571 | + | 132 | WP_001309182.1 | hypothetical protein | - |
| PGH49_RS20965 (4236062) | 4236062..4236319 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
| PGH49_RS20970 (4236331) | 4236331..4236876 | + | 546 | WP_001540600.1 | N-acetyltransferase | Antitoxin |
| PGH49_RS20975 (4236932) | 4236932..4237678 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
| PGH49_RS20980 (4237847) | 4237847..4238065 | + | 219 | Protein_4106 | hypothetical protein | - |
| PGH49_RS20985 (4238103) | 4238103..4238219 | + | 117 | Protein_4107 | VOC family protein | - |
| PGH49_RS20990 (4238464) | 4238464..4239585 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
| PGH49_RS20995 (4239582) | 4239582..4239860 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
| PGH49_RS21000 (4239872) | 4239872..4241185 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimI / fimA / fimE / fimB | 4225848..4245100 | 19252 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T267661 WP_001054376.1 NZ_CP116035:4236062-4236319 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19926.87 Da Isoelectric Point: 6.3277
>AT267661 WP_001540600.1 NZ_CP116035:4236331-4236876 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFGKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|