Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 944799..945453 | Replicon | chromosome |
| Accession | NZ_CP116035 | ||
| Organism | Escherichia coli strain FAH | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PGH49_RS04600 | Protein ID | WP_000244781.1 |
| Coordinates | 945046..945453 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PGH49_RS04595 | Protein ID | WP_000354046.1 |
| Coordinates | 944799..945065 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGH49_RS04575 (940887) | 940887..942320 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
| PGH49_RS04580 (942365) | 942365..942676 | + | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
| PGH49_RS04585 (942840) | 942840..943499 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PGH49_RS04590 (943576) | 943576..944556 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| PGH49_RS04595 (944799) | 944799..945065 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PGH49_RS04600 (945046) | 945046..945453 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PGH49_RS04605 (945493) | 945493..946014 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PGH49_RS04610 (946126) | 946126..947022 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PGH49_RS04615 (947047) | 947047..947757 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PGH49_RS04620 (947763) | 947763..949496 | + | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T267644 WP_000244781.1 NZ_CP116035:945046-945453 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|