Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 1001201..1001772 | Replicon | chromosome |
Accession | NZ_CP116026 | ||
Organism | Enterococcus casseliflavus strain CQFYY22-063 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PEZ80_RS04735 | Protein ID | WP_087627127.1 |
Coordinates | 1001201..1001542 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PEZ80_RS04740 | Protein ID | WP_142973751.1 |
Coordinates | 1001542..1001772 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PEZ80_RS04710 (PEZ80_04710) | 996229..997095 | + | 867 | WP_271292493.1 | class II fructose-bisphosphate aldolase family protein | - |
PEZ80_RS04715 (PEZ80_04715) | 997096..997722 | + | 627 | WP_142973750.1 | zeta toxin family protein | - |
PEZ80_RS04720 (PEZ80_04720) | 997766..998770 | - | 1005 | WP_271292494.1 | DUF389 domain-containing protein | - |
PEZ80_RS04725 (PEZ80_04725) | 998960..999559 | + | 600 | WP_074932236.1 | NUDIX hydrolase | - |
PEZ80_RS04730 (PEZ80_04730) | 999720..1001030 | + | 1311 | WP_271292495.1 | NCS2 family permease | - |
PEZ80_RS04735 (PEZ80_04735) | 1001201..1001542 | - | 342 | WP_087627127.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PEZ80_RS04740 (PEZ80_04740) | 1001542..1001772 | - | 231 | WP_142973751.1 | AbrB family transcriptional regulator | Antitoxin |
PEZ80_RS04745 (PEZ80_04745) | 1002138..1003133 | + | 996 | WP_010747735.1 | LacI family DNA-binding transcriptional regulator | - |
PEZ80_RS04750 (PEZ80_04750) | 1003280..1004656 | + | 1377 | WP_096741465.1 | PTS transporter subunit EIIC | - |
PEZ80_RS04755 (PEZ80_04755) | 1004700..1006142 | + | 1443 | WP_271292496.1 | glycoside hydrolase family 32 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.53 Da Isoelectric Point: 9.4138
>T267639 WP_087627127.1 NZ_CP116026:c1001542-1001201 [Enterococcus casseliflavus]
MMNDQTYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRRTMFAVICPITHTIRKFPTHYTLPDSIDTDGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIEYIF
MMNDQTYIPKKGDIVWIDFDPSAGKEIQKRRPGLVVSRYEFNRRTMFAVICPITHTIRKFPTHYTLPDSIDTDGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|