Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 970597..971204 | Replicon | chromosome |
Accession | NZ_CP116026 | ||
Organism | Enterococcus casseliflavus strain CQFYY22-063 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | PEZ80_RS04600 | Protein ID | WP_115232059.1 |
Coordinates | 970854..971204 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | PEZ80_RS04595 | Protein ID | WP_074932272.1 |
Coordinates | 970597..970860 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PEZ80_RS04575 (PEZ80_04575) | 966322..967614 | + | 1293 | WP_271292477.1 | guanosine 5'-monophosphate oxidoreductase | - |
PEZ80_RS04580 (PEZ80_04580) | 967739..968476 | + | 738 | WP_005225435.1 | tRNA pseudouridine(38-40) synthase TruA | - |
PEZ80_RS04585 (PEZ80_04585) | 968519..969277 | + | 759 | WP_271292478.1 | type I methionyl aminopeptidase | - |
PEZ80_RS04590 (PEZ80_04590) | 969881..969979 | + | 99 | WP_115233064.1 | type I toxin-antitoxin system Fst family toxin | - |
PEZ80_RS04595 (PEZ80_04595) | 970597..970860 | + | 264 | WP_074932272.1 | PbsX family transcriptional regulator | Antitoxin |
PEZ80_RS04600 (PEZ80_04600) | 970854..971204 | + | 351 | WP_115232059.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PEZ80_RS04605 (PEZ80_04605) | 971560..971985 | - | 426 | WP_271292479.1 | AsnC family transcriptional regulator | - |
PEZ80_RS04610 (PEZ80_04610) | 972088..972633 | + | 546 | WP_035006689.1 | cysteine hydrolase family protein | - |
PEZ80_RS04615 (PEZ80_04615) | 972961..973884 | + | 924 | WP_271292480.1 | peptide-methionine (S)-S-oxide reductase MsrA | - |
PEZ80_RS04620 (PEZ80_04620) | 974234..975595 | + | 1362 | WP_271292481.1 | citrate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13022.03 Da Isoelectric Point: 8.0511
>T267638 WP_115232059.1 NZ_CP116026:970854-971204 [Enterococcus casseliflavus]
MVRKPRQGDILLLDTAPRAGHEQTGKRPYIVLSHDMIADYSNVATVAPISSTSRNYPLYVSINPDYGMKTTGKVLLDQLT
TIDYEASACVFLEKAHEHLVDELLMKVRTVFQKVSK
MVRKPRQGDILLLDTAPRAGHEQTGKRPYIVLSHDMIADYSNVATVAPISSTSRNYPLYVSINPDYGMKTTGKVLLDQLT
TIDYEASACVFLEKAHEHLVDELLMKVRTVFQKVSK
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|