Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-yefM/Txe-RelB |
| Location | 457152..457681 | Replicon | chromosome |
| Accession | NZ_CP116026 | ||
| Organism | Enterococcus casseliflavus strain CQFYY22-063 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PEZ80_RS02180 | Protein ID | WP_081116192.1 |
| Coordinates | 457415..457681 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | A0A377KQM1 |
| Locus tag | PEZ80_RS02175 | Protein ID | WP_010748737.1 |
| Coordinates | 457152..457415 (+) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEZ80_RS02160 (PEZ80_02160) | 452721..453986 | - | 1266 | WP_208773556.1 | glycoside hydrolase family 27 protein | - |
| PEZ80_RS02165 (PEZ80_02165) | 454107..455006 | + | 900 | WP_081116191.1 | AraC family transcriptional regulator | - |
| PEZ80_RS02170 (PEZ80_02170) | 455057..456997 | + | 1941 | WP_010748736.1 | glycoside hydrolase family 127 protein | - |
| PEZ80_RS02175 (PEZ80_02175) | 457152..457415 | + | 264 | WP_010748737.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PEZ80_RS02180 (PEZ80_02180) | 457415..457681 | + | 267 | WP_081116192.1 | Txe/YoeB family addiction module toxin | Toxin |
| PEZ80_RS02185 (PEZ80_02185) | 457874..460705 | + | 2832 | WP_081116193.1 | discoidin domain-containing protein | - |
| PEZ80_RS02190 (PEZ80_02190) | 460837..461499 | - | 663 | WP_005227316.1 | ABC transporter permease | - |
| PEZ80_RS02195 (PEZ80_02195) | 461504..462424 | - | 921 | WP_010748740.1 | osmoprotectant ABC transporter substrate-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10672.16 Da Isoelectric Point: 10.0683
>T267637 WP_081116192.1 NZ_CP116026:457415-457681 [Enterococcus casseliflavus]
MRSDTVTIKNSAKVDLRKIKQSNLKKQFEEVIQALKEDPYMPTQSFEKLRPTHEGRYSRRLNRQHRMVYKVDEENKVVEI
YSAWTHYE
MRSDTVTIKNSAKVDLRKIKQSNLKKQFEEVIQALKEDPYMPTQSFEKLRPTHEGRYSRRLNRQHRMVYKVDEENKVVEI
YSAWTHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|