Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB-HicA |
| Location | 19305..19922 | Replicon | plasmid pFYH006-137K |
| Accession | NZ_CP116024 | ||
| Organism | Enterococcus faecium strain CQFYH22-006 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PEZ79_RS12240 | Protein ID | WP_224451579.1 |
| Coordinates | 19305..19457 (+) | Length | 51 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A3F3LXY4 |
| Locus tag | PEZ79_RS12245 | Protein ID | WP_002326154.1 |
| Coordinates | 19491..19922 (+) | Length | 144 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEZ79_RS12185 (PEZ79_12185) | 14885..15361 | + | 477 | WP_002305045.1 | PTS glucose transporter subunit IIA | - |
| PEZ79_RS12190 (PEZ79_12190) | 15629..15715 | + | 87 | Protein_15 | IS200/IS605 family transposase | - |
| PEZ79_RS12195 (PEZ79_12195) | 15710..15913 | + | 204 | Protein_16 | hypothetical protein | - |
| PEZ79_RS12200 (PEZ79_12200) | 16072..16216 | - | 145 | Protein_17 | putative holin-like toxin | - |
| PEZ79_RS12205 (PEZ79_12205) | 16349..16609 | + | 261 | WP_002326514.1 | hypothetical protein | - |
| PEZ79_RS12210 (PEZ79_12210) | 17053..17259 | + | 207 | WP_002305810.1 | hypothetical protein | - |
| PEZ79_RS12215 (PEZ79_12215) | 17259..17510 | + | 252 | WP_002343760.1 | hypothetical protein | - |
| PEZ79_RS12220 (PEZ79_12220) | 17526..17963 | + | 438 | WP_123839631.1 | hypothetical protein | - |
| PEZ79_RS12225 (PEZ79_12225) | 17956..18651 | + | 696 | WP_002305050.1 | hypothetical protein | - |
| PEZ79_RS12230 (PEZ79_12230) | 18816..19016 | + | 201 | WP_123838701.1 | hypothetical protein | - |
| PEZ79_RS12235 (PEZ79_12235) | 19032..19211 | + | 180 | Protein_24 | hypothetical protein | - |
| PEZ79_RS12240 (PEZ79_12240) | 19305..19457 | + | 153 | WP_224451579.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PEZ79_RS12245 (PEZ79_12245) | 19491..19922 | + | 432 | WP_002326154.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PEZ79_RS12250 (PEZ79_12250) | 20103..21251 | - | 1149 | WP_002287525.1 | IS200/IS605 family element RNA-guided endonuclease TnpB | - |
| PEZ79_RS12255 (PEZ79_12255) | 21268..21672 | - | 405 | WP_002287522.1 | IS200/IS605-like element ISEfa4 family transposase | - |
| PEZ79_RS12260 (PEZ79_12260) | 21856..22833 | - | 978 | WP_002326152.1 | choloylglycine hydrolase | - |
| PEZ79_RS12265 (PEZ79_12265) | 22868..24172 | - | 1305 | WP_002343763.1 | conjugated bile salt MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..137763 | 137763 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5815.65 Da Isoelectric Point: 10.3560
>T267636 WP_224451579.1 NZ_CP116024:19305-19457 [Enterococcus faecium]
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
IEKNGWVERRQEGFHHHLYKDGVRITVPVHANQDLGRGLERKILKDAGLK
Download Length: 153 bp
Antitoxin
Download Length: 144 a.a. Molecular weight: 15825.95 Da Isoelectric Point: 4.1638
>AT267636 WP_002326154.1 NZ_CP116024:19491-19922 [Enterococcus faecium]
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKITVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
MLSEPLAKTYPAIFSPEEGGGYFIEFPDVQGAYTGINEDDISYGIAMAQEVLGMVLADYIEHEDLLPEPTPINKITVEDD
SFTTLIRVDVAKYLKDTELVKKTLTIPQWADKLGKRAGINFSVLLTESIADKADNILRSGRNN
Download Length: 432 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|