Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 499552..500123 | Replicon | chromosome |
Accession | NZ_CP116023 | ||
Organism | Enterococcus faecium strain CQFYH22-006 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A828ZXV4 |
Locus tag | PEZ79_RS02395 | Protein ID | WP_002302307.1 |
Coordinates | 499782..500123 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | PEZ79_RS02390 | Protein ID | WP_002323011.1 |
Coordinates | 499552..499782 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PEZ79_RS02365 (PEZ79_02365) | 495003..496361 | + | 1359 | WP_033631190.1 | FAD-containing oxidoreductase | - |
PEZ79_RS02370 (PEZ79_02370) | 496383..497009 | + | 627 | WP_002323734.1 | cysteine hydrolase | - |
PEZ79_RS02375 (PEZ79_02375) | 497202..497783 | + | 582 | WP_002300332.1 | TetR/AcrR family transcriptional regulator | - |
PEZ79_RS02380 (PEZ79_02380) | 498146..498721 | + | 576 | WP_002302305.1 | SOS response-associated peptidase family protein | - |
PEZ79_RS02385 (PEZ79_02385) | 498926..499264 | - | 339 | WP_002286804.1 | hypothetical protein | - |
PEZ79_RS02390 (PEZ79_02390) | 499552..499782 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
PEZ79_RS02395 (PEZ79_02395) | 499782..500123 | + | 342 | WP_002302307.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
PEZ79_RS02405 (PEZ79_02405) | 502589..505093 | + | 2505 | WP_002317782.1 | prealbumin-like fold domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13288.65 Da Isoelectric Point: 9.9044
>T267635 WP_002302307.1 NZ_CP116023:499782-500123 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZXV4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |