Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1297426..1298343 | Replicon | chromosome |
Accession | NZ_CP116014 | ||
Organism | Bacillus velezensis strain SRCM124633 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | PF996_RS06800 | Protein ID | WP_271265756.1 |
Coordinates | 1297597..1298343 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PF996_RS06795 | Protein ID | WP_003154807.1 |
Coordinates | 1297426..1297596 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF996_RS06745 (1292632) | 1292632..1293144 | + | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
PF996_RS06750 (1293257) | 1293257..1293808 | + | 552 | Protein_1269 | terminase | - |
PF996_RS06755 (1293919) | 1293919..1294281 | + | 363 | WP_014721043.1 | hypothetical protein | - |
PF996_RS06760 (1294294) | 1294294..1294665 | + | 372 | WP_017417608.1 | XkdW family protein | - |
PF996_RS06765 (1294670) | 1294670..1294867 | + | 198 | WP_007610833.1 | XkdX family protein | - |
PF996_RS06770 (1294924) | 1294924..1295685 | + | 762 | WP_025649639.1 | hypothetical protein | - |
PF996_RS06775 (1295737) | 1295737..1296000 | + | 264 | WP_100261725.1 | hemolysin XhlA family protein | - |
PF996_RS06780 (1296014) | 1296014..1296277 | + | 264 | WP_003154813.1 | phage holin | - |
PF996_RS06785 (1296291) | 1296291..1297169 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
PF996_RS06790 (1297204) | 1297204..1297329 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PF996_RS06795 (1297426) | 1297426..1297596 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PF996_RS06800 (1297597) | 1297597..1298343 | - | 747 | WP_271265756.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PF996_RS06805 (1298447) | 1298447..1299445 | - | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
PF996_RS06810 (1299458) | 1299458..1300075 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PF996_RS06815 (1300362) | 1300362..1301678 | - | 1317 | WP_007610842.1 | amino acid permease | - |
PF996_RS06820 (1302000) | 1302000..1302950 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29063.54 Da Isoelectric Point: 4.7755
>T267633 WP_271265756.1 NZ_CP116014:c1298343-1297597 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSGQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSGQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|