Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 500143..500780 | Replicon | chromosome |
| Accession | NZ_CP116014 | ||
| Organism | Bacillus velezensis strain SRCM124633 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | PF996_RS02510 | Protein ID | WP_003156187.1 |
| Coordinates | 500430..500780 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | PF996_RS02505 | Protein ID | WP_003156188.1 |
| Coordinates | 500143..500424 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF996_RS02485 (496508) | 496508..497107 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| PF996_RS02490 (497200) | 497200..497565 | + | 366 | WP_007609580.1 | holo-ACP synthase | - |
| PF996_RS02495 (497730) | 497730..498737 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| PF996_RS02500 (498854) | 498854..500023 | + | 1170 | WP_257989017.1 | alanine racemase | - |
| PF996_RS02505 (500143) | 500143..500424 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| PF996_RS02510 (500430) | 500430..500780 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| PF996_RS02515 (500898) | 500898..501719 | + | 822 | WP_257989018.1 | STAS domain-containing protein | - |
| PF996_RS02520 (501724) | 501724..502089 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| PF996_RS02525 (502092) | 502092..502493 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| PF996_RS02530 (502505) | 502505..503512 | + | 1008 | WP_257989019.1 | PP2C family protein-serine/threonine phosphatase | - |
| PF996_RS02535 (503576) | 503576..503905 | + | 330 | WP_016937169.1 | anti-sigma factor antagonist | - |
| PF996_RS02540 (503902) | 503902..504384 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| PF996_RS02545 (504350) | 504350..505138 | + | 789 | WP_257989020.1 | RNA polymerase sigma factor SigB | - |
| PF996_RS02550 (505138) | 505138..505740 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267632 WP_003156187.1 NZ_CP116014:500430-500780 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|