Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3635204..3635840 | Replicon | chromosome |
Accession | NZ_CP116013 | ||
Organism | Bacillus velezensis strain SRCM124349 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PF986_RS17980 | Protein ID | WP_003156187.1 |
Coordinates | 3635490..3635840 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PF986_RS17975 | Protein ID | WP_003225183.1 |
Coordinates | 3635204..3635485 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF986_RS17955 (3631569) | 3631569..3632168 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
PF986_RS17960 (3632261) | 3632261..3632626 | + | 366 | WP_260654792.1 | holo-ACP synthase | - |
PF986_RS17965 (3632791) | 3632791..3633798 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
PF986_RS17970 (3633915) | 3633915..3635084 | + | 1170 | WP_065180972.1 | alanine racemase | - |
PF986_RS17975 (3635204) | 3635204..3635485 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PF986_RS17980 (3635490) | 3635490..3635840 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PF986_RS17985 (3635960) | 3635960..3636781 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PF986_RS17990 (3636786) | 3636786..3637151 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PF986_RS17995 (3637154) | 3637154..3637555 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PF986_RS18000 (3637567) | 3637567..3638574 | + | 1008 | WP_257989019.1 | PP2C family protein-serine/threonine phosphatase | - |
PF986_RS18005 (3638638) | 3638638..3638967 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PF986_RS18010 (3638964) | 3638964..3639446 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
PF986_RS18015 (3639412) | 3639412..3640200 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PF986_RS18020 (3640200) | 3640200..3640802 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267631 WP_003156187.1 NZ_CP116013:3635490-3635840 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|