Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 428411..429328 | Replicon | chromosome |
Accession | NZ_CP116013 | ||
Organism | Bacillus velezensis strain SRCM124349 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | PF986_RS01965 | Protein ID | WP_007407256.1 |
Coordinates | 428582..429328 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PF986_RS01960 | Protein ID | WP_003154807.1 |
Coordinates | 428411..428581 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF986_RS01910 (423617) | 423617..424129 | + | 513 | WP_017417605.1 | sigma-70 family RNA polymerase sigma factor | - |
PF986_RS01915 (424242) | 424242..424793 | + | 552 | Protein_381 | terminase | - |
PF986_RS01920 (424904) | 424904..425266 | + | 363 | WP_014721043.1 | hypothetical protein | - |
PF986_RS01925 (425279) | 425279..425650 | + | 372 | WP_017417608.1 | XkdW family protein | - |
PF986_RS01930 (425655) | 425655..425852 | + | 198 | WP_007610833.1 | XkdX family protein | - |
PF986_RS01935 (425909) | 425909..426670 | + | 762 | WP_025649639.1 | hypothetical protein | - |
PF986_RS01940 (426722) | 426722..426985 | + | 264 | WP_021493821.1 | hemolysin XhlA family protein | - |
PF986_RS01945 (426999) | 426999..427262 | + | 264 | WP_003154813.1 | phage holin | - |
PF986_RS01950 (427276) | 427276..428154 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
PF986_RS01955 (428189) | 428189..428314 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PF986_RS01960 (428411) | 428411..428581 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PF986_RS01965 (428582) | 428582..429328 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PF986_RS01970 (429432) | 429432..430430 | - | 999 | WP_017417610.1 | inorganic phosphate transporter | - |
PF986_RS01975 (430443) | 430443..431060 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PF986_RS01980 (431347) | 431347..432663 | - | 1317 | WP_007610842.1 | amino acid permease | - |
PF986_RS01985 (432985) | 432985..433935 | + | 951 | WP_007610844.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T267630 WP_007407256.1 NZ_CP116013:c429328-428582 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|