Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3788769..3789405 | Replicon | chromosome |
Accession | NZ_CP116012 | ||
Organism | Bacillus subtilis strain SRCM124333 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PF977_RS20085 | Protein ID | WP_003156187.1 |
Coordinates | 3788769..3789119 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | PF977_RS20090 | Protein ID | WP_003225183.1 |
Coordinates | 3789124..3789405 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF977_RS20045 (3783813) | 3783813..3784412 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
PF977_RS20050 (3784412) | 3784412..3785200 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
PF977_RS20055 (3785166) | 3785166..3785648 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
PF977_RS20060 (3785645) | 3785645..3785974 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
PF977_RS20065 (3786036) | 3786036..3787043 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
PF977_RS20070 (3787055) | 3787055..3787456 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
PF977_RS20075 (3787460) | 3787460..3787825 | - | 366 | WP_015715277.1 | RsbT antagonist protein RsbS | - |
PF977_RS20080 (3787830) | 3787830..3788654 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
PF977_RS20085 (3788769) | 3788769..3789119 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PF977_RS20090 (3789124) | 3789124..3789405 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PF977_RS20095 (3789521) | 3789521..3790690 | - | 1170 | WP_003234284.1 | alanine racemase | - |
PF977_RS20100 (3790805) | 3790805..3791821 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
PF977_RS20105 (3791987) | 3791987..3792352 | - | 366 | WP_003234281.1 | holo-ACP synthase | - |
PF977_RS20110 (3792447) | 3792447..3793046 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267629 WP_003156187.1 NZ_CP116012:c3789119-3788769 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|