Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2959268..2960184 | Replicon | chromosome |
Accession | NZ_CP116012 | ||
Organism | Bacillus subtilis strain SRCM124333 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | PF977_RS15520 | Protein ID | WP_015715744.1 |
Coordinates | 2959268..2960014 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | - |
Locus tag | PF977_RS15525 | Protein ID | WP_015715743.1 |
Coordinates | 2960014..2960184 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF977_RS15495 (2954392) | 2954392..2954487 | - | 96 | Protein_3061 | hypothetical protein | - |
PF977_RS15500 (2954596) | 2954596..2955546 | - | 951 | WP_015715745.1 | ring-cleaving dioxygenase | - |
PF977_RS15505 (2955935) | 2955935..2957251 | + | 1317 | WP_015252262.1 | serine/threonine exchanger | - |
PF977_RS15510 (2957527) | 2957527..2958144 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
PF977_RS15515 (2958157) | 2958157..2959158 | + | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
PF977_RS15520 (2959268) | 2959268..2960014 | + | 747 | WP_015715744.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
PF977_RS15525 (2960014) | 2960014..2960184 | + | 171 | WP_015715743.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
PF977_RS15530 (2960270) | 2960270..2960410 | + | 141 | WP_144460135.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
PF977_RS15535 (2960448) | 2960448..2961341 | - | 894 | WP_015715742.1 | N-acetylmuramoyl-L-alanine amidase | - |
PF977_RS15540 (2961354) | 2961354..2961617 | - | 264 | WP_014479566.1 | phage holin | - |
PF977_RS15545 (2961630) | 2961630..2961899 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
PF977_RS15550 (2961952) | 2961952..2962791 | - | 840 | WP_015715741.1 | phage-like element PBSX protein XepA | - |
PF977_RS15555 (2962835) | 2962835..2962999 | - | 165 | WP_015715740.1 | XkdX family protein | - |
PF977_RS15560 (2962996) | 2962996..2963325 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29043.47 Da Isoelectric Point: 4.6191
>T267628 WP_015715744.1 NZ_CP116012:2959268-2960014 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHIYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|