Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1219639..1220555 | Replicon | chromosome |
Accession | NZ_CP116011 | ||
Organism | Bacillus amyloliquefaciens strain SRCM124317 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A7U5AVM4 |
Locus tag | PF976_RS06515 | Protein ID | WP_013351967.1 |
Coordinates | 1219809..1220555 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | PF976_RS06510 | Protein ID | WP_003154807.1 |
Coordinates | 1219639..1219809 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF976_RS06470 (1214780) | 1214780..1216543 | + | 1764 | WP_014470496.1 | hypothetical protein | - |
PF976_RS06475 (1216555) | 1216555..1216881 | + | 327 | WP_014470495.1 | XkdW family protein | - |
PF976_RS06480 (1216881) | 1216881..1217045 | + | 165 | WP_014470494.1 | XkdX family protein | - |
PF976_RS06485 (1217100) | 1217100..1217897 | + | 798 | WP_014470493.1 | hypothetical protein | - |
PF976_RS06490 (1217951) | 1217951..1218214 | + | 264 | WP_013351964.1 | hemolysin XhlA family protein | - |
PF976_RS06495 (1218228) | 1218228..1218491 | + | 264 | WP_014470492.1 | phage holin | - |
PF976_RS06500 (1218505) | 1218505..1219383 | + | 879 | WP_014470491.1 | N-acetylmuramoyl-L-alanine amidase | - |
PF976_RS06505 (1219417) | 1219417..1219542 | - | 126 | WP_003154809.1 | hypothetical protein | - |
PF976_RS06510 (1219639) | 1219639..1219809 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PF976_RS06515 (1219809) | 1219809..1220555 | - | 747 | WP_013351967.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PF976_RS06520 (1220663) | 1220663..1221661 | - | 999 | WP_013351968.1 | inorganic phosphate transporter | - |
PF976_RS06525 (1221674) | 1221674..1222291 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PF976_RS06530 (1222576) | 1222576..1223892 | - | 1317 | WP_013351969.1 | amino acid permease | - |
PF976_RS06535 (1224216) | 1224216..1225166 | + | 951 | WP_013351970.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29054.53 Da Isoelectric Point: 4.6839
>T267618 WP_013351967.1 NZ_CP116011:c1220555-1219809 [Bacillus amyloliquefaciens]
MLLFYQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRQYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFYQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRQYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U5AVM4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | I2HQ14 |