Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 434334..434971 | Replicon | chromosome |
Accession | NZ_CP116011 | ||
Organism | Bacillus amyloliquefaciens strain SRCM124317 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PF976_RS02235 | Protein ID | WP_003156187.1 |
Coordinates | 434621..434971 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PF976_RS02230 | Protein ID | WP_003156188.1 |
Coordinates | 434334..434615 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF976_RS02210 (430700) | 430700..431299 | - | 600 | WP_013351092.1 | rhomboid family intramembrane serine protease | - |
PF976_RS02215 (431392) | 431392..431757 | + | 366 | WP_013351093.1 | holo-ACP synthase | - |
PF976_RS02220 (431922) | 431922..432929 | + | 1008 | WP_013351094.1 | outer membrane lipoprotein carrier protein LolA | - |
PF976_RS02225 (433046) | 433046..434215 | + | 1170 | WP_013351095.1 | alanine racemase | - |
PF976_RS02230 (434334) | 434334..434615 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PF976_RS02235 (434621) | 434621..434971 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PF976_RS02240 (435092) | 435092..435913 | + | 822 | WP_013351096.1 | STAS domain-containing protein | - |
PF976_RS02245 (435918) | 435918..436283 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
PF976_RS02250 (436286) | 436286..436687 | + | 402 | WP_013351097.1 | anti-sigma regulatory factor | - |
PF976_RS02255 (436699) | 436699..437706 | + | 1008 | WP_013351098.1 | PP2C family protein-serine/threonine phosphatase | - |
PF976_RS02260 (437770) | 437770..438099 | + | 330 | WP_014469786.1 | anti-sigma factor antagonist | - |
PF976_RS02265 (438096) | 438096..438578 | + | 483 | WP_013351100.1 | anti-sigma B factor RsbW | - |
PF976_RS02270 (438544) | 438544..439332 | + | 789 | WP_013351101.1 | RNA polymerase sigma factor SigB | - |
PF976_RS02275 (439332) | 439332..439934 | + | 603 | WP_014469787.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267617 WP_003156187.1 NZ_CP116011:434621-434971 [Bacillus amyloliquefaciens]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|