Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3548302..3548939 | Replicon | chromosome |
Accession | NZ_CP116010 | ||
Organism | Bacillus velezensis strain SRCM123815 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | PF975_RS17420 | Protein ID | WP_003156187.1 |
Coordinates | 3548302..3548652 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | PF975_RS17425 | Protein ID | WP_003156188.1 |
Coordinates | 3548658..3548939 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF975_RS17380 (PF975_17380) | 3543342..3543944 | - | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
PF975_RS17385 (PF975_17385) | 3543944..3544732 | - | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
PF975_RS17390 (PF975_17390) | 3544698..3545180 | - | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
PF975_RS17395 (PF975_17395) | 3545177..3545506 | - | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
PF975_RS17400 (PF975_17400) | 3545570..3546577 | - | 1008 | WP_007609589.1 | PP2C family protein-serine/threonine phosphatase | - |
PF975_RS17405 (PF975_17405) | 3546589..3546990 | - | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
PF975_RS17410 (PF975_17410) | 3546993..3547358 | - | 366 | WP_007609584.1 | RsbT antagonist protein RsbS | - |
PF975_RS17415 (PF975_17415) | 3547363..3548184 | - | 822 | WP_003156182.1 | STAS domain-containing protein | - |
PF975_RS17420 (PF975_17420) | 3548302..3548652 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
PF975_RS17425 (PF975_17425) | 3548658..3548939 | - | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
PF975_RS17430 (PF975_17430) | 3549059..3550228 | - | 1170 | WP_053285486.1 | alanine racemase | - |
PF975_RS17435 (PF975_17435) | 3550345..3551352 | - | 1008 | WP_021495080.1 | outer membrane lipoprotein carrier protein LolA | - |
PF975_RS17440 (PF975_17440) | 3551517..3551882 | - | 366 | WP_014304402.1 | holo-ACP synthase | - |
PF975_RS17445 (PF975_17445) | 3551975..3552574 | + | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T267616 WP_003156187.1 NZ_CP116010:c3548652-3548302 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|