Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2776992..2777909 | Replicon | chromosome |
Accession | NZ_CP116010 | ||
Organism | Bacillus velezensis strain SRCM123815 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | PF975_RS13315 | Protein ID | WP_007407256.1 |
Coordinates | 2776992..2777738 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2C3Z8 |
Locus tag | PF975_RS13320 | Protein ID | WP_014417527.1 |
Coordinates | 2777739..2777909 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF975_RS13295 (PF975_13295) | 2772383..2773333 | - | 951 | WP_014417529.1 | ring-cleaving dioxygenase | - |
PF975_RS13300 (PF975_13300) | 2773655..2774971 | + | 1317 | WP_007610842.1 | amino acid permease | - |
PF975_RS13305 (PF975_13305) | 2775257..2775874 | + | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
PF975_RS13310 (PF975_13310) | 2775887..2776885 | + | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
PF975_RS13315 (PF975_13315) | 2776992..2777738 | + | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
PF975_RS13320 (PF975_13320) | 2777739..2777909 | + | 171 | WP_014417527.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
PF975_RS13325 (PF975_13325) | 2778006..2778131 | + | 126 | WP_003154809.1 | hypothetical protein | - |
PF975_RS13330 (PF975_13330) | 2778166..2779044 | - | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
PF975_RS13335 (PF975_13335) | 2779058..2779321 | - | 264 | WP_003154813.1 | phage holin | - |
PF975_RS13340 (PF975_13340) | 2779335..2779598 | - | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
PF975_RS13345 (PF975_13345) | 2779650..2780411 | - | 762 | WP_014417526.1 | hypothetical protein | - |
PF975_RS13350 (PF975_13350) | 2780468..2780665 | - | 198 | WP_007610833.1 | XkdX family protein | - |
PF975_RS13355 (PF975_13355) | 2780670..2781041 | - | 372 | WP_022553475.1 | XkdW family protein | - |
PF975_RS13360 (PF975_13360) | 2781054..2781416 | - | 363 | WP_254912362.1 | hypothetical protein | - |
PF975_RS13365 (PF975_13365) | 2781527..2782078 | - | 552 | Protein_2634 | terminase | - |
PF975_RS13370 (PF975_13370) | 2782191..2782703 | - | 513 | WP_012117362.1 | sigma-70 family RNA polymerase sigma factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T267615 WP_007407256.1 NZ_CP116010:2776992-2777738 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|