Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/UPF0150(antitoxin)
Location 2867278..2867933 Replicon chromosome
Accession NZ_CP116006
Organism Achromobacter mucicolens strain DMF-4

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag PE062_RS13195 Protein ID WP_223575987.1
Coordinates 2867278..2867454 (+) Length 59 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PE062_RS13200 Protein ID WP_271265336.1
Coordinates 2867511..2867933 (+) Length 141 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE062_RS13165 (PE062_13165) 2862480..2862905 + 426 WP_128828573.1 copper resistance protein NlpE -
PE062_RS13170 (PE062_13170) 2862987..2863735 + 749 Protein_2603 ABC transporter substrate-binding protein -
PE062_RS13175 (PE062_13175) 2863808..2864140 - 333 WP_179689439.1 zinc ribbon domain-containing protein -
PE062_RS13180 (PE062_13180) 2864150..2865379 - 1230 WP_179689440.1 acetamidase/formamidase family protein -
PE062_RS13185 (PE062_13185) 2866162..2866824 + 663 WP_271265334.1 SOS response-associated peptidase family protein -
PE062_RS13190 (PE062_13190) 2866880..2867188 + 309 WP_271265335.1 hypothetical protein -
PE062_RS13195 (PE062_13195) 2867278..2867454 + 177 WP_223575987.1 type II toxin-antitoxin system HicA family toxin Toxin
PE062_RS13200 (PE062_13200) 2867511..2867933 + 423 WP_271265336.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PE062_RS13205 (PE062_13205) 2868036..2868437 - 402 WP_271265337.1 hypothetical protein -
PE062_RS13210 (PE062_13210) 2868434..2868844 - 411 WP_271265338.1 M15 family metallopeptidase -
PE062_RS13215 (PE062_13215) 2868841..2869119 - 279 WP_271265339.1 hypothetical protein -
PE062_RS13220 (PE062_13220) 2869121..2869429 - 309 WP_271265340.1 hypothetical protein -
PE062_RS13225 (PE062_13225) 2869800..2870024 - 225 WP_271265341.1 hypothetical protein -
PE062_RS13230 (PE062_13230) 2870026..2871219 - 1194 WP_271265342.1 hypothetical protein -
PE062_RS13235 (PE062_13235) 2871220..2871870 - 651 WP_271265343.1 DUF2612 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2866162..2919613 53451


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-57)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 59 a.a.        Molecular weight: 6643.62 Da        Isoelectric Point: 11.1063

>T267612 WP_223575987.1 NZ_CP116006:2867278-2867454 [Achromobacter mucicolens]
VKQSEFKRWLASKGVTFAEGSNHTKAYYNGKQTTLPRHPSKELRDGTRQNILKKLGLK

Download         Length: 177 bp

Antitoxin


Download         Length: 141 a.a.        Molecular weight: 15448.76 Da        Isoelectric Point: 4.6400

>AT267612 WP_271265336.1 NZ_CP116006:2867511-2867933 [Achromobacter mucicolens]
MARYPAFLDPEGDGFNVTFRDIPEAITCGDNRDDALEMAAGALVTAMEFYFEDRRPVPLPSDPKDGEVLIALPASVWAKV
LLLNEMIAQRVTPAELARRLNTRPQEVTRIINLGHATKIDTIAAALRTMGKDLEISVRQA

Download         Length: 423 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References