Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2867278..2867933 | Replicon | chromosome |
| Accession | NZ_CP116006 | ||
| Organism | Achromobacter mucicolens strain DMF-4 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PE062_RS13195 | Protein ID | WP_223575987.1 |
| Coordinates | 2867278..2867454 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PE062_RS13200 | Protein ID | WP_271265336.1 |
| Coordinates | 2867511..2867933 (+) | Length | 141 a.a. |
Genomic Context
Location: 2862480..2862905 (426 bp)
Type: Others
Protein ID: WP_128828573.1
Type: Others
Protein ID: WP_128828573.1
Location: 2862987..2863735 (749 bp)
Type: Others
Protein ID: Protein_2603
Type: Others
Protein ID: Protein_2603
Location: 2866162..2866824 (663 bp)
Type: Others
Protein ID: WP_271265334.1
Type: Others
Protein ID: WP_271265334.1
Location: 2866880..2867188 (309 bp)
Type: Others
Protein ID: WP_271265335.1
Type: Others
Protein ID: WP_271265335.1
Location: 2867278..2867454 (177 bp)
Type: Toxin
Protein ID: WP_223575987.1
Type: Toxin
Protein ID: WP_223575987.1
Location: 2867511..2867933 (423 bp)
Type: Antitoxin
Protein ID: WP_271265336.1
Type: Antitoxin
Protein ID: WP_271265336.1
Location: 2863808..2864140 (333 bp)
Type: Others
Protein ID: WP_179689439.1
Type: Others
Protein ID: WP_179689439.1
Location: 2864150..2865379 (1230 bp)
Type: Others
Protein ID: WP_179689440.1
Type: Others
Protein ID: WP_179689440.1
Location: 2868036..2868437 (402 bp)
Type: Others
Protein ID: WP_271265337.1
Type: Others
Protein ID: WP_271265337.1
Location: 2868434..2868844 (411 bp)
Type: Others
Protein ID: WP_271265338.1
Type: Others
Protein ID: WP_271265338.1
Location: 2868841..2869119 (279 bp)
Type: Others
Protein ID: WP_271265339.1
Type: Others
Protein ID: WP_271265339.1
Location: 2869121..2869429 (309 bp)
Type: Others
Protein ID: WP_271265340.1
Type: Others
Protein ID: WP_271265340.1
Location: 2869800..2870024 (225 bp)
Type: Others
Protein ID: WP_271265341.1
Type: Others
Protein ID: WP_271265341.1
Location: 2870026..2871219 (1194 bp)
Type: Others
Protein ID: WP_271265342.1
Type: Others
Protein ID: WP_271265342.1
Location: 2871220..2871870 (651 bp)
Type: Others
Protein ID: WP_271265343.1
Type: Others
Protein ID: WP_271265343.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE062_RS13165 (PE062_13165) | 2862480..2862905 | + | 426 | WP_128828573.1 | copper resistance protein NlpE | - |
| PE062_RS13170 (PE062_13170) | 2862987..2863735 | + | 749 | Protein_2603 | ABC transporter substrate-binding protein | - |
| PE062_RS13175 (PE062_13175) | 2863808..2864140 | - | 333 | WP_179689439.1 | zinc ribbon domain-containing protein | - |
| PE062_RS13180 (PE062_13180) | 2864150..2865379 | - | 1230 | WP_179689440.1 | acetamidase/formamidase family protein | - |
| PE062_RS13185 (PE062_13185) | 2866162..2866824 | + | 663 | WP_271265334.1 | SOS response-associated peptidase family protein | - |
| PE062_RS13190 (PE062_13190) | 2866880..2867188 | + | 309 | WP_271265335.1 | hypothetical protein | - |
| PE062_RS13195 (PE062_13195) | 2867278..2867454 | + | 177 | WP_223575987.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PE062_RS13200 (PE062_13200) | 2867511..2867933 | + | 423 | WP_271265336.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PE062_RS13205 (PE062_13205) | 2868036..2868437 | - | 402 | WP_271265337.1 | hypothetical protein | - |
| PE062_RS13210 (PE062_13210) | 2868434..2868844 | - | 411 | WP_271265338.1 | M15 family metallopeptidase | - |
| PE062_RS13215 (PE062_13215) | 2868841..2869119 | - | 279 | WP_271265339.1 | hypothetical protein | - |
| PE062_RS13220 (PE062_13220) | 2869121..2869429 | - | 309 | WP_271265340.1 | hypothetical protein | - |
| PE062_RS13225 (PE062_13225) | 2869800..2870024 | - | 225 | WP_271265341.1 | hypothetical protein | - |
| PE062_RS13230 (PE062_13230) | 2870026..2871219 | - | 1194 | WP_271265342.1 | hypothetical protein | - |
| PE062_RS13235 (PE062_13235) | 2871220..2871870 | - | 651 | WP_271265343.1 | DUF2612 domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2866162..2919613 | 53451 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6643.62 Da Isoelectric Point: 11.1063
>T267612 WP_223575987.1 NZ_CP116006:2867278-2867454 [Achromobacter mucicolens]
VKQSEFKRWLASKGVTFAEGSNHTKAYYNGKQTTLPRHPSKELRDGTRQNILKKLGLK
VKQSEFKRWLASKGVTFAEGSNHTKAYYNGKQTTLPRHPSKELRDGTRQNILKKLGLK
Download Length: 177 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15448.76 Da Isoelectric Point: 4.6400
>AT267612 WP_271265336.1 NZ_CP116006:2867511-2867933 [Achromobacter mucicolens]
MARYPAFLDPEGDGFNVTFRDIPEAITCGDNRDDALEMAAGALVTAMEFYFEDRRPVPLPSDPKDGEVLIALPASVWAKV
LLLNEMIAQRVTPAELARRLNTRPQEVTRIINLGHATKIDTIAAALRTMGKDLEISVRQA
MARYPAFLDPEGDGFNVTFRDIPEAITCGDNRDDALEMAAGALVTAMEFYFEDRRPVPLPSDPKDGEVLIALPASVWAKV
LLLNEMIAQRVTPAELARRLNTRPQEVTRIINLGHATKIDTIAAALRTMGKDLEISVRQA
Download Length: 423 bp