Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 3970073..3970610 | Replicon | chromosome |
Accession | NZ_CP116005 | ||
Organism | Sphingosinicella microcystinivorans strain DMF-3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | PE061_RS19165 | Protein ID | WP_271256806.1 |
Coordinates | 3970073..3970375 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | PE061_RS19170 | Protein ID | WP_271256807.1 |
Coordinates | 3970365..3970610 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE061_RS19145 (PE061_19145) | 3965290..3966783 | + | 1494 | WP_271256802.1 | amidase | - |
PE061_RS19150 (PE061_19150) | 3966797..3967183 | + | 387 | WP_271256803.1 | arsenate reductase family protein | - |
PE061_RS19155 (PE061_19155) | 3967219..3969762 | + | 2544 | WP_271256804.1 | type I DNA topoisomerase | - |
PE061_RS19160 (PE061_19160) | 3969768..3969947 | + | 180 | WP_271256805.1 | hypothetical protein | - |
PE061_RS19165 (PE061_19165) | 3970073..3970375 | - | 303 | WP_271256806.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PE061_RS19170 (PE061_19170) | 3970365..3970610 | - | 246 | WP_271256807.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
PE061_RS19175 (PE061_19175) | 3970770..3971087 | + | 318 | WP_271256808.1 | quaternary ammonium compound efflux SMR transporter SugE | - |
PE061_RS19180 (PE061_19180) | 3971128..3973338 | + | 2211 | WP_271256809.1 | ribonuclease R | - |
PE061_RS19185 (PE061_19185) | 3973355..3973603 | - | 249 | WP_271256810.1 | Hpt domain-containing protein | - |
PE061_RS19190 (PE061_19190) | 3973773..3973940 | + | 168 | WP_046348982.1 | 50S ribosomal protein L33 | - |
PE061_RS19195 (PE061_19195) | 3973962..3974324 | - | 363 | WP_271256811.1 | response regulator | - |
PE061_RS19200 (PE061_19200) | 3974429..3974707 | + | 279 | WP_271256812.1 | DUF3572 domain-containing protein | - |
PE061_RS19205 (PE061_19205) | 3974704..3975315 | + | 612 | WP_271256813.1 | HAD family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11200.65 Da Isoelectric Point: 6.8805
>T267611 WP_271256806.1 NZ_CP116005:c3970375-3970073 [Sphingosinicella microcystinivorans]
MAGRRGGFRLTPRAEADLEDIFTYTAERWSLMQAEDHHAGFAAAFEKLGSGERSGRAAGVPGAYLKYAVGSHLVFYREPE
SEIIVVRVLHQRMDVGRYLE
MAGRRGGFRLTPRAEADLEDIFTYTAERWSLMQAEDHHAGFAAAFEKLGSGERSGRAAGVPGAYLKYAVGSHLVFYREPE
SEIIVVRVLHQRMDVGRYLE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|