Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 3964610..3965160 | Replicon | chromosome |
| Accession | NZ_CP116005 | ||
| Organism | Sphingosinicella microcystinivorans strain DMF-3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | PE061_RS19135 | Protein ID | WP_271256800.1 |
| Coordinates | 3964610..3964900 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PE061_RS19140 | Protein ID | WP_271256801.1 |
| Coordinates | 3964897..3965160 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE061_RS19105 (PE061_19105) | 3960451..3960864 | - | 414 | WP_271256795.1 | VOC family protein | - |
| PE061_RS19110 (PE061_19110) | 3960953..3961135 | - | 183 | WP_271256796.1 | CsbD family protein | - |
| PE061_RS19115 (PE061_19115) | 3961227..3962204 | - | 978 | WP_271256797.1 | sulfur carrier protein ThiS | - |
| PE061_RS19120 (PE061_19120) | 3962312..3962752 | + | 441 | WP_271256798.1 | type II 3-dehydroquinate dehydratase | - |
| PE061_RS19125 (PE061_19125) | 3962809..3963252 | + | 444 | WP_271259252.1 | acetyl-CoA carboxylase biotin carboxyl carrier protein | - |
| PE061_RS19130 (PE061_19130) | 3963254..3964606 | + | 1353 | WP_271256799.1 | acetyl-CoA carboxylase biotin carboxylase subunit | - |
| PE061_RS19135 (PE061_19135) | 3964610..3964900 | - | 291 | WP_271256800.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PE061_RS19140 (PE061_19140) | 3964897..3965160 | - | 264 | WP_271256801.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| PE061_RS19145 (PE061_19145) | 3965290..3966783 | + | 1494 | WP_271256802.1 | amidase | - |
| PE061_RS19150 (PE061_19150) | 3966797..3967183 | + | 387 | WP_271256803.1 | arsenate reductase family protein | - |
| PE061_RS19155 (PE061_19155) | 3967219..3969762 | + | 2544 | WP_271256804.1 | type I DNA topoisomerase | - |
| PE061_RS19160 (PE061_19160) | 3969768..3969947 | + | 180 | WP_271256805.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11166.88 Da Isoelectric Point: 10.4120
>T267610 WP_271256800.1 NZ_CP116005:c3964900-3964610 [Sphingosinicella microcystinivorans]
MKILWTSKASGDLARLFEFLKPVAPDAAARVIRGLVNAPDRLLAWPRIGERHDAYAPREVRRIIVGNYEMRYEVRDTEIV
VLRVWHTRENRNPTGE
MKILWTSKASGDLARLFEFLKPVAPDAAARVIRGLVNAPDRLLAWPRIGERHDAYAPREVRRIIVGNYEMRYEVRDTEIV
VLRVWHTRENRNPTGE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|