Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 2946317..2946876 | Replicon | chromosome |
Accession | NZ_CP116005 | ||
Organism | Sphingosinicella microcystinivorans strain DMF-3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PE061_RS14105 | Protein ID | WP_271255891.1 |
Coordinates | 2946583..2946876 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PE061_RS14100 | Protein ID | WP_271255890.1 |
Coordinates | 2946317..2946586 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE061_RS14065 (PE061_14065) | 2942091..2942975 | - | 885 | WP_271255883.1 | replication initiator protein A | - |
PE061_RS14070 (PE061_14070) | 2942972..2943238 | - | 267 | WP_271255884.1 | helix-turn-helix domain-containing protein | - |
PE061_RS14075 (PE061_14075) | 2943368..2944003 | - | 636 | WP_271255885.1 | DUF2285 domain-containing protein | - |
PE061_RS14080 (PE061_14080) | 2943930..2944133 | - | 204 | WP_271255886.1 | DUF6499 domain-containing protein | - |
PE061_RS14085 (PE061_14085) | 2944285..2944551 | - | 267 | WP_271255887.1 | DUF2285 domain-containing protein | - |
PE061_RS14090 (PE061_14090) | 2945057..2945281 | - | 225 | WP_271255888.1 | hypothetical protein | - |
PE061_RS14095 (PE061_14095) | 2945341..2945988 | - | 648 | WP_271255889.1 | DNA methyltransferase | - |
PE061_RS14100 (PE061_14100) | 2946317..2946586 | + | 270 | WP_271255890.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
PE061_RS14105 (PE061_14105) | 2946583..2946876 | + | 294 | WP_271255891.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PE061_RS14110 (PE061_14110) | 2947008..2947208 | - | 201 | WP_271255892.1 | hypothetical protein | - |
PE061_RS14115 (PE061_14115) | 2947209..2947871 | - | 663 | WP_271255893.1 | hypothetical protein | - |
PE061_RS14120 (PE061_14120) | 2948066..2948278 | - | 213 | WP_271255894.1 | hypothetical protein | - |
PE061_RS14130 (PE061_14130) | 2949045..2949323 | - | 279 | WP_271255895.1 | BolA family protein | - |
PE061_RS14135 (PE061_14135) | 2949377..2950228 | - | 852 | WP_271255896.1 | type II CAAX endopeptidase family protein | - |
PE061_RS14140 (PE061_14140) | 2950361..2950948 | + | 588 | WP_271255897.1 | J domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11427.00 Da Isoelectric Point: 6.8714
>T267609 WP_271255891.1 NZ_CP116005:2946583-2946876 [Sphingosinicella microcystinivorans]
MRIQWTTKASSDLVRLHDHLSPVAPDAAARVVQQLAHAPDRLLDYPRIGEKLEAYEPREVRRIIVGDYELRYEIASATIF
ILRLWHCRENRRFDSED
MRIQWTTKASSDLVRLHDHLSPVAPDAAARVVQQLAHAPDRLLDYPRIGEKLEAYEPREVRRIIVGDYELRYEIASATIF
ILRLWHCRENRRFDSED
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|