Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3168707..3169370 | Replicon | chromosome |
Accession | NZ_CP116004 | ||
Organism | Edwardsiella piscicida strain CC2 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A411H3S7 |
Locus tag | PED70_RS14650 | Protein ID | WP_034167931.1 |
Coordinates | 3168707..3169123 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D0ZDY6 |
Locus tag | PED70_RS14655 | Protein ID | WP_012849755.1 |
Coordinates | 3169104..3169370 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED70_RS14630 (PED70_14630) | 3164638..3166371 | - | 1734 | WP_012849750.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PED70_RS14635 (PED70_14635) | 3166376..3167092 | - | 717 | WP_012849751.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PED70_RS14640 (PED70_14640) | 3167120..3168019 | - | 900 | WP_012849752.1 | site-specific tyrosine recombinase XerD | - |
PED70_RS14645 (PED70_14645) | 3168170..3168682 | + | 513 | WP_012849753.1 | flavodoxin FldB | - |
PED70_RS14650 (PED70_14650) | 3168707..3169123 | - | 417 | WP_034167931.1 | protein YgfX | Toxin |
PED70_RS14655 (PED70_14655) | 3169104..3169370 | - | 267 | WP_012849755.1 | FAD assembly factor SdhE | Antitoxin |
PED70_RS14660 (PED70_14660) | 3169724..3170722 | + | 999 | WP_012849756.1 | tRNA-modifying protein YgfZ | - |
PED70_RS14665 (PED70_14665) | 3170765..3171589 | - | 825 | WP_012849757.1 | shikimate 5-dehydrogenase | - |
PED70_RS14670 (PED70_14670) | 3171748..3172620 | - | 873 | WP_012849758.1 | nucleoside-specific channel-forming protein Tsx | - |
PED70_RS14675 (PED70_14675) | 3173229..3173879 | + | 651 | WP_015462279.1 | hemolysin III family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16213.03 Da Isoelectric Point: 11.6049
>T267606 WP_034167931.1 NZ_CP116004:c3169123-3168707 [Edwardsiella piscicida]
VVLWRCNVHVSWRTQVMFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRRIARNRGELQLLAPQVWHWQLR
EWRLARRPWVSDLGALLILQSTHGAPCRRRLWLAADSMSREEWGQLRRTLLDAGDDRA
VVLWRCNVHVSWRTQVMFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRRIARNRGELQLLAPQVWHWQLR
EWRLARRPWVSDLGALLILQSTHGAPCRRRLWLAADSMSREEWGQLRRTLLDAGDDRA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A411H3S7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A034T2Q8 |