Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2963832..2964564 Replicon chromosome
Accession NZ_CP116004
Organism Edwardsiella piscicida strain CC2

Toxin (Protein)


Gene name ypjF Uniprot ID A0A411H496
Locus tag PED70_RS13740 Protein ID WP_015683453.1
Coordinates 2964235..2964564 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A411H489
Locus tag PED70_RS13735 Protein ID WP_015683452.1
Coordinates 2963832..2964197 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PED70_RS13690 (PED70_13690) 2959075..2959788 + 714 WP_041692656.1 WYL domain-containing protein -
PED70_RS13695 (PED70_13695) 2959785..2960405 + 621 WP_041692657.1 hypothetical protein -
PED70_RS13700 (PED70_13700) 2960440..2960891 + 452 Protein_2647 hypothetical protein -
PED70_RS13705 (PED70_13705) 2960888..2961337 + 450 WP_015683447.1 IrmA family protein -
PED70_RS13710 (PED70_13710) 2961409..2961639 + 231 WP_015683448.1 DUF905 domain-containing protein -
PED70_RS13715 (PED70_13715) 2961738..2962559 + 822 WP_041692658.1 DUF932 domain-containing protein -
PED70_RS13720 (PED70_13720) 2962590..2963033 + 444 WP_047414857.1 antirestriction protein -
PED70_RS13725 (PED70_13725) 2963046..2963588 + 543 WP_041692659.1 DNA repair protein RadC -
PED70_RS13730 (PED70_13730) 2963585..2963806 + 222 WP_015683451.1 DUF987 domain-containing protein -
PED70_RS13735 (PED70_13735) 2963832..2964197 + 366 WP_015683452.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PED70_RS13740 (PED70_13740) 2964235..2964564 + 330 WP_015683453.1 TA system toxin CbtA family protein Toxin
PED70_RS13745 (PED70_13745) 2964944..2965240 + 297 WP_012849576.1 YciI family protein -
PED70_RS13750 (PED70_13750) 2965357..2965743 - 387 WP_012849577.1 RidA family protein -
PED70_RS13755 (PED70_13755) 2965780..2966106 - 327 WP_012849578.1 AzlD domain-containing protein -
PED70_RS13760 (PED70_13760) 2966099..2966836 - 738 WP_172454870.1 AzlC family ABC transporter permease -
PED70_RS13765 (PED70_13765) 2966900..2968183 - 1284 WP_012849580.1 L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12617.29 Da        Isoelectric Point: 9.5061

>T267605 WP_015683453.1 NZ_CP116004:2964235-2964564 [Edwardsiella piscicida]
MQTLSSHPTRSTQPYLSPVETWQRLLTHLFSQHYGLTLNDTPFSNETTIREHIDAGVSLSDAVNFLVEKYELIRIDRKGF
SWQQQTPYISVVDILRARRNTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13477.21 Da        Isoelectric Point: 5.8743

>AT267605 WP_015683452.1 NZ_CP116004:2963832-2964197 [Edwardsiella piscicida]
MNNHSESGTKPENLTCQQWGLKRTITPCFGARLVQEGNRVHFLADRAGFNGAFSDNDALRLDQAFPLMLKQLELMLTSGE
LSPLHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQPEPH

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A411H496

Antitoxin

Source ID Structure
AlphaFold DB A0A411H489

References