Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 1714324..1714846 | Replicon | chromosome |
Accession | NZ_CP116004 | ||
Organism | Edwardsiella piscicida strain CC2 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PED70_RS07905 | Protein ID | WP_069578568.1 |
Coordinates | 1714324..1714605 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A411H7D8 |
Locus tag | PED70_RS07910 | Protein ID | WP_069578569.1 |
Coordinates | 1714595..1714846 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED70_RS07890 (PED70_07890) | 1709710..1710486 | + | 777 | WP_073382315.1 | hypothetical protein | - |
PED70_RS07895 (PED70_07895) | 1710479..1712140 | + | 1662 | WP_165362063.1 | terminase | - |
PED70_RS07900 (PED70_07900) | 1712137..1714251 | + | 2115 | WP_129986139.1 | portal protein | - |
PED70_RS07905 (PED70_07905) | 1714324..1714605 | - | 282 | WP_069578568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PED70_RS07910 (PED70_07910) | 1714595..1714846 | - | 252 | WP_069578569.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PED70_RS07915 (PED70_07915) | 1715124..1716125 | + | 1002 | WP_129986135.1 | hypothetical protein | - |
PED70_RS07920 (PED70_07920) | 1716143..1717381 | + | 1239 | WP_280977425.1 | N4-gp56 family major capsid protein | - |
PED70_RS07925 (PED70_07925) | 1717440..1717835 | + | 396 | WP_080783446.1 | hypothetical protein | - |
PED70_RS07930 (PED70_07930) | 1717877..1718320 | + | 444 | WP_080783445.1 | hypothetical protein | - |
PED70_RS07935 (PED70_07935) | 1718386..1718901 | + | 516 | WP_236721582.1 | hypothetical protein | - |
PED70_RS07940 (PED70_07940) | 1718901..1719563 | + | 663 | WP_109579934.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1676447..1737917 | 61470 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10738.62 Da Isoelectric Point: 10.6993
>T267600 WP_069578568.1 NZ_CP116004:c1714605-1714324 [Edwardsiella piscicida]
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHIPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNDVYLAADGR
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHIPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGK
RADNDVYLAADGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|