Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3168857..3169520 | Replicon | chromosome |
Accession | NZ_CP116003 | ||
Organism | Edwardsiella piscicida strain CC1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PED68_RS14650 | Protein ID | WP_045474345.1 |
Coordinates | 3168857..3169225 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D0ZDY6 |
Locus tag | PED68_RS14655 | Protein ID | WP_012849755.1 |
Coordinates | 3169254..3169520 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED68_RS14630 (PED68_14630) | 3164788..3166521 | - | 1734 | WP_012849750.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PED68_RS14635 (PED68_14635) | 3166526..3167242 | - | 717 | WP_012849751.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PED68_RS14640 (PED68_14640) | 3167270..3168169 | - | 900 | WP_012849752.1 | site-specific tyrosine recombinase XerD | - |
PED68_RS14645 (PED68_14645) | 3168320..3168832 | + | 513 | WP_012849753.1 | flavodoxin FldB | - |
PED68_RS14650 (PED68_14650) | 3168857..3169225 | - | 369 | WP_045474345.1 | protein YgfX | Toxin |
PED68_RS14655 (PED68_14655) | 3169254..3169520 | - | 267 | WP_012849755.1 | FAD assembly factor SdhE | Antitoxin |
PED68_RS14660 (PED68_14660) | 3169874..3170872 | + | 999 | WP_012849756.1 | tRNA-modifying protein YgfZ | - |
PED68_RS14665 (PED68_14665) | 3170915..3171739 | - | 825 | WP_012849757.1 | shikimate 5-dehydrogenase | - |
PED68_RS14670 (PED68_14670) | 3171898..3172770 | - | 873 | WP_012849758.1 | nucleoside-specific channel-forming protein Tsx | - |
PED68_RS14675 (PED68_14675) | 3173379..3174029 | + | 651 | WP_015462279.1 | hemolysin III family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14248.71 Da Isoelectric Point: 11.3493
>T267597 WP_045474345.1 NZ_CP116003:c3169225-3168857 [Edwardsiella piscicida]
MFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRRIARNRGELQLLAPQVWHWQLREWRLARRPWVSDLGAL
LILQSTHGAPCRRRLWLAADSMSREEWGQLRRTLLDAGDDRA
MFLLGHGALVLAILLAPWPENYSVFWLILLVAVIFECIRSQRRIARNRGELQLLAPQVWHWQLREWRLARRPWVSDLGAL
LILQSTHGAPCRRRLWLAADSMSREEWGQLRRTLLDAGDDRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|