Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ypjF-yeeU/CbtA-CbeA
Location 2963981..2964713 Replicon chromosome
Accession NZ_CP116003
Organism Edwardsiella piscicida strain CC1

Toxin (Protein)


Gene name ypjF Uniprot ID A0A411H496
Locus tag PED68_RS13735 Protein ID WP_015683453.1
Coordinates 2964384..2964713 (+) Length 110 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A411H489
Locus tag PED68_RS13730 Protein ID WP_015683452.1
Coordinates 2963981..2964346 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PED68_RS13685 (PED68_13685) 2959224..2959937 + 714 WP_041692656.1 WYL domain-containing protein -
PED68_RS13690 (PED68_13690) 2959934..2960554 + 621 WP_041692657.1 hypothetical protein -
PED68_RS13695 (PED68_13695) 2960589..2961040 + 452 Protein_2646 hypothetical protein -
PED68_RS13700 (PED68_13700) 2961037..2961486 + 450 WP_015683447.1 IrmA family protein -
PED68_RS13705 (PED68_13705) 2961558..2961788 + 231 WP_015683448.1 DUF905 domain-containing protein -
PED68_RS13710 (PED68_13710) 2961887..2962708 + 822 WP_041692658.1 DUF932 domain-containing protein -
PED68_RS13715 (PED68_13715) 2962739..2963182 + 444 WP_047414857.1 antirestriction protein -
PED68_RS13720 (PED68_13720) 2963195..2963737 + 543 WP_041692659.1 DNA repair protein RadC -
PED68_RS13725 (PED68_13725) 2963734..2963955 + 222 WP_015683451.1 DUF987 domain-containing protein -
PED68_RS13730 (PED68_13730) 2963981..2964346 + 366 WP_015683452.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PED68_RS13735 (PED68_13735) 2964384..2964713 + 330 WP_015683453.1 TA system toxin CbtA family protein Toxin
PED68_RS13740 (PED68_13740) 2965093..2965389 + 297 WP_012849576.1 YciI family protein -
PED68_RS13745 (PED68_13745) 2965506..2965892 - 387 WP_012849577.1 RidA family protein -
PED68_RS13750 (PED68_13750) 2965929..2966255 - 327 WP_012849578.1 AzlD domain-containing protein -
PED68_RS13755 (PED68_13755) 2966248..2966985 - 738 WP_172454870.1 AzlC family ABC transporter permease -
PED68_RS13760 (PED68_13760) 2967049..2968332 - 1284 WP_012849580.1 L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-108)

Antitoxin

Antitoxin CbeA

(17-117)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12617.29 Da        Isoelectric Point: 9.5061

>T267596 WP_015683453.1 NZ_CP116003:2964384-2964713 [Edwardsiella piscicida]
MQTLSSHPTRSTQPYLSPVETWQRLLTHLFSQHYGLTLNDTPFSNETTIREHIDAGVSLSDAVNFLVEKYELIRIDRKGF
SWQQQTPYISVVDILRARRNTGLLKTNVK

Download         Length: 330 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13477.21 Da        Isoelectric Point: 5.8743

>AT267596 WP_015683452.1 NZ_CP116003:2963981-2964346 [Edwardsiella piscicida]
MNNHSESGTKPENLTCQQWGLKRTITPCFGARLVQEGNRVHFLADRAGFNGAFSDNDALRLDQAFPLMLKQLELMLTSGE
LSPLHQHCVTLYHNGLTCEADTLGSCGYVYIAIYPDQPEPH

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A411H496

Antitoxin

Source ID Structure
AlphaFold DB A0A411H489

References