Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1092316..1092908 | Replicon | chromosome |
Accession | NZ_CP116003 | ||
Organism | Edwardsiella piscicida strain CC1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | D0ZEC2 |
Locus tag | PED68_RS04865 | Protein ID | WP_012847872.1 |
Coordinates | 1092316..1092519 (-) | Length | 68 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A411GZW1 |
Locus tag | PED68_RS04870 | Protein ID | WP_015461125.1 |
Coordinates | 1092540..1092908 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED68_RS04835 (PED68_04835) | 1088041..1088502 | + | 462 | WP_012847865.1 | Lrp/AsnC family transcriptional regulator | - |
PED68_RS04840 (PED68_04840) | 1088807..1089145 | + | 339 | WP_012847867.1 | P-II family nitrogen regulator | - |
PED68_RS04845 (PED68_04845) | 1089167..1090447 | + | 1281 | WP_041692495.1 | ammonium transporter AmtB | - |
PED68_RS04850 (PED68_04850) | 1090482..1091348 | - | 867 | WP_012847869.1 | acyl-CoA thioesterase II | - |
PED68_RS04855 (PED68_04855) | 1091457..1091786 | - | 330 | WP_225857588.1 | MGMT family protein | - |
PED68_RS04865 (PED68_04865) | 1092316..1092519 | - | 204 | WP_012847872.1 | HHA domain-containing protein | Toxin |
PED68_RS04870 (PED68_04870) | 1092540..1092908 | - | 369 | WP_015461125.1 | Hha toxicity modulator TomB | Antitoxin |
PED68_RS04875 (PED68_04875) | 1093277..1096429 | - | 3153 | WP_012847874.1 | efflux RND transporter permease subunit | - |
PED68_RS04880 (PED68_04880) | 1096473..1097657 | - | 1185 | WP_034168424.1 | efflux RND transporter periplasmic adaptor subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8103.37 Da Isoelectric Point: 5.0914
>T267590 WP_012847872.1 NZ_CP116003:c1092519-1092316 [Edwardsiella piscicida]
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
MTKIDYLMKLRKCTTLDTLERVIEKNKYELSDDELEIFYSAADHRLAELTMNKLYDKIPAEVWQYVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14099.80 Da Isoelectric Point: 6.1484
>AT267590 WP_015461125.1 NZ_CP116003:c1092908-1092540 [Edwardsiella piscicida]
MDEYTSYQHDIAELKYLCDSLYHQGIDVLGESHHGWVSDPTAKVNLQLNELIEHIASVAQSFKIKYPHHSDLAEILDDYL
DETYALFGAYSVSETALRHWLRTKRRVAYCLAHEKRNAALHV
MDEYTSYQHDIAELKYLCDSLYHQGIDVLGESHHGWVSDPTAKVNLQLNELIEHIASVAQSFKIKYPHHSDLAEILDDYL
DETYALFGAYSVSETALRHWLRTKRRVAYCLAHEKRNAALHV
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A034SMG4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A411GZW1 |