Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 104262..105399 | Replicon | plasmid pESC2 |
Accession | NZ_CP115994 | ||
Organism | Enterococcus faecalis strain ESC1 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | PE069_RS14960 | Protein ID | WP_002333003.1 |
Coordinates | 104262..105125 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | B3CKC7 |
Locus tag | PE069_RS14965 | Protein ID | WP_002333002.1 |
Coordinates | 105127..105399 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE069_RS14935 (99555) | 99555..100061 | + | 507 | WP_271232482.1 | IS30 family transposase | - |
PE069_RS14940 (100133) | 100133..101746 | - | 1614 | WP_002333004.1 | hypothetical protein | - |
PE069_RS14945 (101770) | 101770..102651 | - | 882 | WP_002326774.1 | ABC transporter ATP-binding protein | - |
PE069_RS14950 (102962) | 102962..103558 | + | 597 | WP_085442989.1 | TetR/AcrR family transcriptional regulator | - |
PE069_RS14955 (103727) | 103727..104131 | - | 405 | Protein_115 | DnaJ domain-containing protein | - |
PE069_RS14960 (104262) | 104262..105125 | - | 864 | WP_002333003.1 | zeta toxin family protein | Toxin |
PE069_RS14965 (105127) | 105127..105399 | - | 273 | WP_002333002.1 | antitoxin | Antitoxin |
PE069_RS14970 (105417) | 105417..105632 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
PE069_RS14975 (105724) | 105724..106620 | - | 897 | WP_104681373.1 | ParA family protein | - |
PE069_RS14980 (106723) | 106723..108558 | - | 1836 | WP_232035937.1 | type IA DNA topoisomerase | - |
PE069_RS14985 (108788) | 108788..109006 | + | 219 | WP_271232473.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | erm(A) / optrA / fexA / cat / tet(L) / tet(M) / dfrG / aph(3')-III / erm(B) | prgB/asc10 / asa1 | 1..141731 | 141731 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32365.76 Da Isoelectric Point: 6.3643
>T267589 WP_002333003.1 NZ_CP115994:c105125-104262 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|