Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 71565..72136 Replicon plasmid pESC2
Accession NZ_CP115994
Organism Enterococcus faecalis strain ESC1

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag PE069_RS14760 Protein ID WP_002394791.1
Coordinates 71565..71906 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PE069_RS14765 Protein ID WP_002362431.1
Coordinates 71906..72136 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE069_RS14740 (68009) 68009..68491 + 483 WP_010817773.1 PTS glucose transporter subunit IIA -
PE069_RS14745 (68731) 68731..69411 + 681 WP_071621256.1 IS6 family transposase -
PE069_RS14750 (69645) 69645..70247 - 603 WP_002367780.1 Fic family protein -
PE069_RS14755 (70515) 70515..71453 - 939 WP_002394789.1 hypothetical protein -
PE069_RS14760 (71565) 71565..71906 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PE069_RS14765 (71906) 71906..72136 - 231 WP_002362431.1 hypothetical protein Antitoxin
PE069_RS14770 (72340) 72340..72960 + 621 WP_002367784.1 recombinase family protein -
PE069_RS14775 (72950) 72950..73264 + 315 WP_002367785.1 hypothetical protein -
PE069_RS14780 (73258) 73258..73464 + 207 WP_002367786.1 hypothetical protein -
PE069_RS14785 (73624) 73624..73818 + 195 WP_002367787.1 hypothetical protein -
PE069_RS14790 (73830) 73830..74021 + 192 WP_002367788.1 hypothetical protein -
PE069_RS14795 (74191) 74191..74406 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
PE069_RS14800 (74407) 74407..74748 + 342 WP_002367792.1 bacteriocin immunity protein -
PE069_RS14805 (75164) 75164..75682 + 519 WP_002367793.1 hypothetical protein -
PE069_RS14810 (75630) 75630..75845 + 216 WP_002415356.1 hypothetical protein -
PE069_RS14815 (75937) 75937..76023 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
PE069_RS14820 (76280) 76280..76576 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(A) / optrA / fexA / cat / tet(L) / tet(M) / dfrG / aph(3')-III / erm(B) prgB/asc10 / asa1 1..141731 141731
- flank IS/Tn - - 68830..69411 581


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T267588 WP_002394791.1 NZ_CP115994:c71906-71565 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT267588 WP_002362431.1 NZ_CP115994:c72136-71906 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References