Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 22492..23063 Replicon plasmid pESC2
Accession NZ_CP115994
Organism Enterococcus faecalis strain ESC1

Toxin (Protein)


Gene name mazF Uniprot ID A0A1G1SBA4
Locus tag PE069_RS14500 Protein ID WP_070416029.1
Coordinates 22722..23063 (+) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag PE069_RS14495 Protein ID WP_002362431.1
Coordinates 22492..22722 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE069_RS14455 (18436) 18436..18735 - 300 WP_126300999.1 type III secretion system protein PrgN -
- (18844) 18844..18935 + 92 NuclAT_0 - -
- (18844) 18844..18935 + 92 NuclAT_0 - -
- (18844) 18844..18935 + 92 NuclAT_0 - -
- (18844) 18844..18935 + 92 NuclAT_0 - -
PE069_RS14460 (18975) 18975..19064 - 90 WP_153829630.1 type I toxin-antitoxin system Fst family toxin -
PE069_RS14465 (19580) 19580..19897 + 318 WP_002394802.1 heavy metal-binding domain-containing protein -
PE069_RS14470 (19933) 19933..20601 + 669 WP_002403283.1 CPBP family intramembrane metalloprotease -
PE069_RS14475 (20718) 20718..20972 + 255 WP_002394800.1 hypothetical protein -
PE069_RS14480 (21132) 21132..21365 - 234 WP_002394799.1 hypothetical protein -
PE069_RS14485 (21367) 21367..21651 - 285 WP_002394798.1 hypothetical protein -
PE069_RS14490 (21668) 21668..22288 - 621 WP_013438829.1 recombinase family protein -
PE069_RS14495 (22492) 22492..22722 + 231 WP_002362431.1 hypothetical protein Antitoxin
PE069_RS14500 (22722) 22722..23063 + 342 WP_070416029.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PE069_RS14505 (23175) 23175..24113 + 939 WP_002362433.1 hypothetical protein -
PE069_RS14510 (24378) 24378..24980 + 603 WP_002362434.1 Fic family protein -
PE069_RS14515 (25119) 25119..26275 + 1157 WP_271232474.1 IS3 family transposase -
PE069_RS14520 (26705) 26705..27304 + 600 WP_070415749.1 tyrosine-type recombinase/integrase -
PE069_RS14525 (27353) 27353..27490 + 138 WP_170965568.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(A) / optrA / fexA / cat / tet(L) / tet(M) / dfrG / aph(3')-III / erm(B) prgB/asc10 / asa1 1..141731 141731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13226.41 Da        Isoelectric Point: 8.0113

>T267587 WP_070416029.1 NZ_CP115994:22722-23063 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEIETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT267587 WP_002362431.1 NZ_CP115994:22492-22722 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1G1SBA4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References