Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 26489..27108 | Replicon | plasmid pESC1 |
| Accession | NZ_CP115993 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3H4V2 |
| Locus tag | PE069_RS14145 | Protein ID | WP_000241511.1 |
| Coordinates | 26489..26851 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3H5D1 |
| Locus tag | PE069_RS14150 | Protein ID | WP_000245205.1 |
| Coordinates | 26845..27108 (-) | Length | 88 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS14130 (PE069_14130) | 21899..23830 | - | 1932 | WP_010816308.1 | sucrose-specific PTS transporter subunit IIBC | - |
| PE069_RS14135 (PE069_14135) | 24021..25460 | + | 1440 | WP_002367771.1 | sucrose-6-phosphate hydrolase | - |
| PE069_RS14140 (PE069_14140) | 25462..26424 | + | 963 | WP_002367770.1 | LacI family DNA-binding transcriptional regulator | - |
| PE069_RS14145 (PE069_14145) | 26489..26851 | - | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PE069_RS14150 (PE069_14150) | 26845..27108 | - | 264 | WP_000245205.1 | PbsX family transcriptional regulator | Antitoxin |
| PE069_RS14155 (PE069_14155) | 27435..28799 | - | 1365 | WP_159156973.1 | SEC-C metal-binding domain-containing protein | - |
| PE069_RS14160 (PE069_14160) | 29225..29311 | - | 87 | WP_271232472.1 | putative holin-like toxin | - |
| PE069_RS14165 (PE069_14165) | 29436..29597 | - | 162 | WP_181039656.1 | hypothetical protein | - |
| PE069_RS14170 (PE069_14170) | 29610..30200 | - | 591 | WP_159156972.1 | thermonuclease family protein | - |
| PE069_RS14175 (PE069_14175) | 30298..30747 | - | 450 | WP_104801932.1 | single-stranded DNA-binding protein | - |
| PE069_RS14180 (PE069_14180) | 30872..31069 | + | 198 | WP_014862324.1 | hypothetical protein | - |
| PE069_RS14185 (PE069_14185) | 31145..31408 | + | 264 | WP_010817818.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..73156 | 73156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13585.78 Da Isoelectric Point: 9.6107
>T267586 WP_000241511.1 NZ_CP115993:c26851-26489 [Enterococcus faecalis]
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
MVKVPHQGDILLLNTAPRSGHEQTGKRPYIVLSHDIIADYSNVVIVAPISSTKRNYPLYVSINPSYGMKTSGKVLLDQLT
TIDYEARQCVFLETAHEKLIDELLLKVRTVFQKVNKTNKF
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|