Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 8168..8739 | Replicon | plasmid pESC1 |
| Accession | NZ_CP115993 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2P6BPI5 |
| Locus tag | PE069_RS14065 | Protein ID | WP_002394791.1 |
| Coordinates | 8398..8739 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | PE069_RS14060 | Protein ID | WP_002362431.1 |
| Coordinates | 8168..8398 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS14030 (PE069_14030) | 3358..3966 | - | 609 | WP_224798875.1 | polysaccharide deacetylase family protein | - |
| PE069_RS14035 (PE069_14035) | 4301..5821 | - | 1521 | WP_271232469.1 | hypothetical protein | - |
| PE069_RS14040 (PE069_14040) | 6575..6760 | - | 186 | WP_169061676.1 | DNA helicase UvrB | - |
| PE069_RS14045 (PE069_14045) | 6822..7046 | - | 225 | WP_010711817.1 | hypothetical protein | - |
| PE069_RS14050 (PE069_14050) | 7040..7327 | - | 288 | Protein_10 | hypothetical protein | - |
| PE069_RS14055 (PE069_14055) | 7344..7964 | - | 621 | WP_163326451.1 | recombinase family protein | - |
| PE069_RS14060 (PE069_14060) | 8168..8398 | + | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| PE069_RS14065 (PE069_14065) | 8398..8739 | + | 342 | WP_002394791.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PE069_RS14070 (PE069_14070) | 8851..9789 | + | 939 | WP_002394789.1 | hypothetical protein | - |
| PE069_RS14075 (PE069_14075) | 10057..10659 | + | 603 | WP_271232470.1 | Fic family protein | - |
| PE069_RS14080 (PE069_14080) | 10893..11573 | - | 681 | WP_002367779.1 | IS6 family transposase | - |
| PE069_RS14085 (PE069_14085) | 11828..12766 | + | 939 | WP_002335374.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | prgB/asc10 | 1..73156 | 73156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13248.49 Da Isoelectric Point: 8.8595
>T267585 WP_002394791.1 NZ_CP115993:8398-8739 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P6BPI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |