Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2059727..2060380 | Replicon | chromosome |
| Accession | NZ_CP115992 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | R3IHS7 |
| Locus tag | PE069_RS09815 | Protein ID | WP_002367585.1 |
| Coordinates | 2060198..2060380 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R3IHD2 |
| Locus tag | PE069_RS09810 | Protein ID | WP_010707936.1 |
| Coordinates | 2059727..2060164 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS09795 (2055003) | 2055003..2055701 | + | 699 | WP_010707934.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| PE069_RS09800 (2055879) | 2055879..2058218 | + | 2340 | WP_071646506.1 | alpha-glucosidase | - |
| PE069_RS09805 (2058765) | 2058765..2059682 | + | 918 | WP_010713649.1 | helix-turn-helix transcriptional regulator | - |
| PE069_RS09810 (2059727) | 2059727..2060164 | - | 438 | WP_010707936.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PE069_RS09815 (2060198) | 2060198..2060380 | - | 183 | WP_002367585.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PE069_RS09820 (2060485) | 2060485..2061138 | - | 654 | WP_002356081.1 | Crp/Fnr family transcriptional regulator | - |
| PE069_RS09825 (2061412) | 2061412..2062305 | + | 894 | WP_010775474.1 | SDR family oxidoreductase | - |
| PE069_RS09830 (2062318) | 2062318..2062890 | + | 573 | WP_071646507.1 | alkaline shock response membrane anchor protein AmaP | - |
| PE069_RS09835 (2062903) | 2062903..2063094 | + | 192 | WP_002356087.1 | DUF2273 domain-containing protein | - |
| PE069_RS09840 (2063107) | 2063107..2063619 | + | 513 | WP_002383483.1 | Asp23/Gls24 family envelope stress response protein | - |
| PE069_RS09845 (2063678) | 2063678..2064238 | + | 561 | WP_002356090.1 | Asp23/Gls24 family envelope stress response protein | - |
| PE069_RS09850 (2064262) | 2064262..2064504 | + | 243 | WP_002356092.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| PE069_RS09855 (2064670) | 2064670..2065185 | + | 516 | WP_271232351.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6633.06 Da Isoelectric Point: 10.8756
>T267581 WP_002367585.1 NZ_CP115992:c2060380-2060198 [Enterococcus faecalis]
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16267.27 Da Isoelectric Point: 4.2758
>AT267581 WP_010707936.1 NZ_CP115992:c2060164-2059727 [Enterococcus faecalis]
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|