267581

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2059727..2060380 Replicon chromosome
Accession NZ_CP115992
Organism Enterococcus faecalis strain ESC1

Toxin (Protein)


Gene name hicA Uniprot ID R3IHS7
Locus tag PE069_RS09815 Protein ID WP_002367585.1
Coordinates 2060198..2060380 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID R3IHD2
Locus tag PE069_RS09810 Protein ID WP_010707936.1
Coordinates 2059727..2060164 (-) Length 146 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PE069_RS09795 (2055003) 2055003..2055701 + 699 WP_010707934.1 N-acetylmannosamine-6-phosphate 2-epimerase -
PE069_RS09800 (2055879) 2055879..2058218 + 2340 WP_071646506.1 alpha-glucosidase -
PE069_RS09805 (2058765) 2058765..2059682 + 918 WP_010713649.1 helix-turn-helix transcriptional regulator -
PE069_RS09810 (2059727) 2059727..2060164 - 438 WP_010707936.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PE069_RS09815 (2060198) 2060198..2060380 - 183 WP_002367585.1 type II toxin-antitoxin system HicA family toxin Toxin
PE069_RS09820 (2060485) 2060485..2061138 - 654 WP_002356081.1 Crp/Fnr family transcriptional regulator -
PE069_RS09825 (2061412) 2061412..2062305 + 894 WP_010775474.1 SDR family oxidoreductase -
PE069_RS09830 (2062318) 2062318..2062890 + 573 WP_071646507.1 alkaline shock response membrane anchor protein AmaP -
PE069_RS09835 (2062903) 2062903..2063094 + 192 WP_002356087.1 DUF2273 domain-containing protein -
PE069_RS09840 (2063107) 2063107..2063619 + 513 WP_002383483.1 Asp23/Gls24 family envelope stress response protein -
PE069_RS09845 (2063678) 2063678..2064238 + 561 WP_002356090.1 Asp23/Gls24 family envelope stress response protein -
PE069_RS09850 (2064262) 2064262..2064504 + 243 WP_002356092.1 GlsB/YeaQ/YmgE family stress response membrane protein -
PE069_RS09855 (2064670) 2064670..2065185 + 516 WP_271232351.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(11-71)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6633.06 Da        Isoelectric Point: 10.8756

>T267581 WP_002367585.1 NZ_CP115992:c2060380-2060198 [Enterococcus faecalis]
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 146 a.a.        Molecular weight: 16267.27 Da        Isoelectric Point: 4.2758

>AT267581 WP_010707936.1 NZ_CP115992:c2060164-2059727 [Enterococcus faecalis]
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK

Download         Length: 438 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R3IHS7

Antitoxin

Source ID Structure
AlphaFold DB R3IHD2

References