Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 1885155..1885726 | Replicon | chromosome |
| Accession | NZ_CP115992 | ||
| Organism | Enterococcus faecalis strain ESC1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | R3GRA7 |
| Locus tag | PE069_RS09020 | Protein ID | WP_002360937.1 |
| Coordinates | 1885155..1885496 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S4CGQ1 |
| Locus tag | PE069_RS09025 | Protein ID | WP_002367500.1 |
| Coordinates | 1885496..1885726 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PE069_RS09015 (1881019) | 1881019..1884633 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| PE069_RS09020 (1885155) | 1885155..1885496 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| PE069_RS09025 (1885496) | 1885496..1885726 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
| PE069_RS09030 (1886049) | 1886049..1886264 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| PE069_RS09035 (1886403) | 1886403..1887395 | + | 993 | WP_192177101.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| PE069_RS09040 (1887485) | 1887485..1888084 | - | 600 | WP_225560887.1 | RloB family protein | - |
| PE069_RS09045 (1888093) | 1888093..1889388 | - | 1296 | WP_192177102.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T267574 WP_002360937.1 NZ_CP115992:c1885496-1885155 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2A7G9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S4CGQ1 |