Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 1536539..1537237 | Replicon | chromosome |
Accession | NZ_CP115992 | ||
Organism | Enterococcus faecalis strain ESC1 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | PE069_RS07380 | Protein ID | WP_010827745.1 |
Coordinates | 1536893..1537237 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | PE069_RS07375 | Protein ID | WP_023895324.1 |
Coordinates | 1536539..1536874 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PE069_RS07325 (1531666) | 1531666..1532421 | - | 756 | WP_271232260.1 | DnaD domain protein | - |
PE069_RS07330 (1532436) | 1532436..1533251 | - | 816 | WP_161972134.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
PE069_RS07335 (1533214) | 1533214..1534185 | - | 972 | WP_104878921.1 | RecT family recombinase | - |
PE069_RS07340 (1534235) | 1534235..1534555 | + | 321 | WP_010707143.1 | hypothetical protein | - |
PE069_RS07345 (1534574) | 1534574..1534879 | - | 306 | WP_002395805.1 | hypothetical protein | - |
PE069_RS07350 (1534982) | 1534982..1535206 | - | 225 | WP_002367281.1 | hypothetical protein | - |
PE069_RS07355 (1535203) | 1535203..1535502 | - | 300 | WP_010706856.1 | hypothetical protein | - |
PE069_RS07360 (1535569) | 1535569..1535748 | - | 180 | WP_010829956.1 | hypothetical protein | - |
PE069_RS07365 (1535783) | 1535783..1536052 | - | 270 | WP_002365131.1 | hypothetical protein | - |
PE069_RS07370 (1536065) | 1536065..1536247 | - | 183 | WP_002358110.1 | hypothetical protein | - |
PE069_RS07375 (1536539) | 1536539..1536874 | + | 336 | WP_023895324.1 | helix-turn-helix transcriptional regulator | Antitoxin |
PE069_RS07380 (1536893) | 1536893..1537237 | + | 345 | WP_010827745.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
PE069_RS07385 (1537295) | 1537295..1538023 | + | 729 | WP_002385631.1 | potassium channel family protein | - |
PE069_RS07390 (1538178) | 1538178..1539359 | + | 1182 | WP_271232261.1 | site-specific integrase | - |
PE069_RS07395 (1539462) | 1539462..1539611 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
PE069_RS07400 (1539737) | 1539737..1541872 | - | 2136 | WP_002359399.1 | penicillin-binding protein 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1496526..1539359 | 42833 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13580.58 Da Isoelectric Point: 5.6177
>T267564 WP_010827745.1 NZ_CP115992:1536893-1537237 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|